(data stored in ACNUC7421 zone)

EMBL: CP002160.PE101

CP002160.PE101       Location/Qualifiers
FT   CDS_pept        176247..176450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbi:CLJ_B0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49892"
FT                   /db_xref="GOA:D9SNM1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM1"
FT                   /inference="similar to AA sequence:KEGG:CLJ_B0092"
FT                   /protein_id="ADL49892.1"
FT                   /translation="MKAVLKISNLNTSKDINAVKSAIISNEGIMACQISKSTGDVNIVY
FT                   DQYFTSIDEIIESIENAGYIVI"
     gtgaaggcag tattaaaaat tagtaattta aatacctcaa aggatatcaa tgctgtaaaa        60
     agtgccataa tttctaacga aggtattatg gcatgtcaga tatccaaaag tactggggat       120
     gttaatatcg tatatgatca atacttcaca tctatagatg aaataattga aagtatagaa       180
     aatgctggtt atattgtgat ataa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page