(data stored in ACNUC7421 zone)

EMBL: CP002160.PE104

CP002160.PE104       Location/Qualifiers
FT   CDS_pept        178168..178902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0106"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: cno:NT01CX_0753
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49895"
FT                   /db_xref="GOA:D9SNM4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM4"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADL49895.1"
FT                   /translation="MDFLKADETLDDLQLKDIQVIQKKDAFRFGVDAVLLANFANVKRS
FT                   HRVIDLCTGTGIIPFILAGKTESNSIVGIEIQDEFVEMADRTVEYNKLQERVSFHCRDL
FT                   KDLAFLKTLGLVDVVTVNPPYKLQNSGLINPNDKNAIARHEILCTLEDVIIASKAVLKD
FT                   NGRLYMVHRPDRLADIFCLMRKHNIEPKRVRMVHPSVGKAPNIVLVEGQKFGGAFLKWD
FT                   TPLYVHEEDGSYTREIDEIYGR"
     atggattttt tgaaagctga tgagactttg gatgatttgc aattaaagga tatacaagta        60
     atacagaaga aggacgcatt tagattcggt gtagatgcag tattgcttgc aaactttgct       120
     aatgttaaaa gaagtcatag agttatagat ttatgtacgg gtactgggat aattcctttt       180
     atactagcag gaaaaacaga gagcaattct atagtaggaa ttgagattca agatgaattc       240
     gttgaaatgg cagataggac tgtggaatat aataagttgc aagagcgagt aagttttcat       300
     tgtagggact taaaggactt agctttttta aaaaccttag ggttagtaga tgtggtaaca       360
     gttaatccac cgtataagct ccaaaactcg gggttaatta atcctaatga taagaatgct       420
     attgctaggc atgagatcct ttgtacatta gaagacgtta taatcgcctc taaggcagtt       480
     ttaaaggata atggaagact atacatggtt catagaccag ataggcttgc agatatattc       540
     tgtctaatga gaaaacataa tatagaacca aagagagtta gaatggttca tccttcagtt       600
     gggaaagctc ctaatatagt gttagtggaa ggacagaaat ttggtggtgc attcttaaag       660
     tgggatacac ctttatatgt ccatgaggaa gatggaagct acactagaga aatagatgag       720
     atatatggta ggtaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page