(data stored in ACNUC7421 zone)

EMBL: CP002160.PE105

CP002160.PE105       Location/Qualifiers
FT   CDS_pept        179013..179858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0107"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cbe:Cbei_4886
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49896"
FT                   /db_xref="GOA:D9SNM5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM5"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADL49896.1"
FT                   /translation="MSGKLYIVGTPIGNLRDITIRALDTLKECDMVAAEDTRVTLKLLN
FT                   HFEIKKPLISYHKYNEKDKSADILELVKEGKNIALVSDAGMPGISDPGSILIERAVAED
FT                   VPFEVIPGATAVITALVYSALDTTSFTFRGFFPRENKEREALFADIENYKDTLIFYESP
FT                   YRIVQTLQYIKDRLGNRRIAICREITKLYESIFRGTVEEAYEFFNENSPKGEFVLVLEG
FT                   KTLEEIDREERATWEHMTIEDHIVMEMKQGHSKKEAIKLVAKARGMAKNDVYKYSIDID
FT                   "
     atgagtggta agttatatat agtaggaacc cctattggaa atttaagaga tataaccata        60
     agagcattgg ataccttaaa ggagtgcgat atggttgcag cagaggatac tagggtgact       120
     cttaagcttt taaatcattt tgagattaaa aagcctttga ttagttatca taagtataat       180
     gagaaggata aaagtgctga catattagaa cttgttaaag aaggtaagaa tatagcattg       240
     gttagtgatg caggaatgcc agggatttca gacccaggct ctatcttgat tgaaagagca       300
     gtggctgaag atgtgccttt tgaggttatt ccaggagcta cagcggttat aacagccttg       360
     gtttattcag cattagatac aacaagcttt acctttagag gatttttccc aagggagaat       420
     aaagaaagag aagcattatt tgctgatata gagaattata aggatacttt aattttttat       480
     gaatctccat atagaatagt gcaaacactt caatatatca aagatagatt aggaaaccgt       540
     agaatagcta tatgtagaga aataactaag ctatatgaaa gtatctttag aggaactgta       600
     gaagaagcct atgaattctt taatgagaat tctccaaaag gggaatttgt attagtttta       660
     gaaggaaaga ccttagaaga gatagatagg gaagaaagag ctacttggga acatatgacc       720
     atagaggatc atattgtcat ggagatgaag caaggtcata gtaaaaaaga ggctataaag       780
     cttgttgcta aggcaagggg tatggcgaag aatgatgtct acaaatattc aatagatata       840
     gattaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page