(data stored in ACNUC7421 zone)

EMBL: CP002160.PE107

CP002160.PE107       Location/Qualifiers
FT   CDS_pept        complement(181556..181795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0109"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: cno:NT01CX_0750 transition state regulatory
FT                   protein AbrB; TIGRFAM: transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49898"
FT                   /db_xref="GOA:D9SNM7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM7"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADL49898.1"
FT                   /translation="MKSTGVVRRVDELGRIVIPIELRRTLDIAEKDALEIYVDGEEIIL
FT                   KKYEPACIFCGDARNVENYKGKNICHNCLEELKK"
     atgaaatcaa caggtgtagt tagaagagta gacgaactag gaagaatagt tattccaatc        60
     gaattaagaa gaactttaga catagcagaa aaagatgcgt tagaaatata cgtagatggt       120
     gaagaaataa tattaaagaa atatgaacca gcttgtatat tctgtggaga tgcaagaaac       180
     gttgaaaatt acaaaggtaa aaatatttgc cataattgtt tagaagaatt aaagaaataa       240
//

If you have problems or comments...

PBIL Back to PBIL home page