(data stored in ACNUC7421 zone)

EMBL: CP002160.PE110

CP002160.PE110       Location/Qualifiers
FT   CDS_pept        complement(185611..186423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0112"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: cbb:CLD_3176
FT                   manganese/zinc/iron chelate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49901"
FT                   /db_xref="GOA:D9SNN0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN0"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADL49901.1"
FT                   /translation="MLQYEFMRNALLGALFISILCPTVGIFLVLKRYSMMGDTLAHNSF
FT                   AGIALGLMIGANPLLSAFVVTSVAGLLIEFLRKYLNKYADLIMSIVLTLGIGIGITLIS
FT                   TGKASGNINSYLFGSMLTVTKGELKTMAILGIITAITLIFIFNDLVYITFDEEGAKIAG
FT                   IKVKLINYIFILLVSATIAVSVKIVGILVISSMITLPVATALQFKKGFKATMIIGIFTG
FT                   IIDIMLGLISSYYLDAAPGGLIALTSVIVLLSVIVLRRLLSNISALRN"
     atgttacaat acgagtttat gcgaaatgcc ctattaggtg cgttatttat atcaattctt        60
     tgccctactg tgggtatttt tttagtttta aaaagatatt ctatgatggg agacacctta       120
     gctcataatt cctttgctgg catagcctta ggtcttatga ttggtgctaa tccactttta       180
     tcagcttttg tagtaacttc agttgctgga cttcttatag aatttcttag gaaatactta       240
     aacaaatatg ctgaccttat aatgtccatt gttttaactc tcggtattgg aattggaatt       300
     acattgatta gtacaggaaa agcttctgga aatataaatt cttatctctt tggtagtatg       360
     cttactgtaa ctaaaggtga attaaagaca atggctattt taggaattat aacagcaatt       420
     actttgatat ttatattcaa tgatttagta tatataacct ttgacgaaga gggcgcaaaa       480
     atcgctggaa taaaggtaaa gttaataaat tatatcttta tccttcttgt aagtgctact       540
     atagctgttt ctgtaaagat agtaggaata ttggttatct cctcaatgat aactcttcct       600
     gtagctactg ccttacaatt taaaaaaggt tttaaggcta ctatgattat aggaatcttc       660
     actggcatca tagacattat gctaggatta atttcttcct attatttaga tgctgcacct       720
     ggaggactta tcgccttaac ttccgtaatt gttttattat cagttatagt cttaagaaga       780
     ttactttcaa acatctctgc tttaagaaat tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page