(data stored in ACNUC7421 zone)

EMBL: CP002160.PE111

CP002160.PE111       Location/Qualifiers
FT   CDS_pept        complement(186433..187086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0113"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbf:CLI_1460 manganese/zinc/iron chelate ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49902"
FT                   /db_xref="GOA:D9SNN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49902.1"
FT                   /translation="MIEIKSLSFSYNNKAPYIVNDVSLKINKGEYVSIIGENGCGKSTL
FT                   IKLLLGIVKHSKGSVAINSPKIGYVPQRLDSNSSFPITVNEALQSHLKALKLKDKSLVD
FT                   NILDSLGMKKYKHRLIGSLSGGQQQKIFIARALLGEPEVLILDEPSNNIDVKSQEEIYG
FT                   IIKDLNLTKGVTVVSVEHNLKAARDNSTHIFEMTNNTTKLFDVEKYIAFSDLCE"
     gtgatagaaa tcaaaagctt gtccttttct tataataata aagcacccta tatagttaat        60
     gatgtatcac taaaaattaa taaaggtgaa tatgtatcta ttataggtga gaatggatgt       120
     gggaaaagta cactaataaa acttcttctt ggaatagtga aacattccaa aggttctgta       180
     gctataaata gtcctaaaat aggttatgtt cctcagcgac tagacagtaa tagtagtttt       240
     ccaattacag tgaatgaagc tctccaaagc catctcaagg ctttaaagct taaagataag       300
     tctcttgtag ataatattct agattcactt ggtatgaaaa aatataaaca tagactaata       360
     ggtagcttat ctggtggaca acaacagaaa atttttatag ctcgtgccct attaggtgaa       420
     cctgaagtac ttatattaga tgaaccatct aataatatag atgtaaaaag ccaagaagaa       480
     atatatggaa taatcaaaga cttaaactta acaaagggtg ttaccgttgt gtctgttgaa       540
     cacaatctta aagcagccag agacaactca actcatattt ttgagatgac aaacaatact       600
     acaaaactat ttgatgtaga aaaatacatt gcatttagtg atctatgtga atag             654
//

If you have problems or comments...

PBIL Back to PBIL home page