(data stored in ACNUC7421 zone)

EMBL: CP002160.PE112

CP002160.PE112       Location/Qualifiers
FT   CDS_pept        187454..188662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0114"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: cno:NT01CX_0749 polyA polymerase family
FT                   protein; PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49903"
FT                   /db_xref="GOA:D9SNN2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN2"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ADL49903.1"
FT                   /translation="MKETIQLLKSYMKNKEDKIYIVGEYVRDKLKDSSKEPKTLDIVVD
FT                   GNEACLIKYLEAHEFKFDKLKDKQRGHKKTKESEELYIWTNKGQNIEEYLQGVDFTVNA
FT                   IALDIKDNKMIDPYNGRRDIKSKLVNEVMQESISKAPIRIITAIKLSLENGMHLGGFTE
FT                   EHIRLYKDKIDESDKDELYEALLSLFSKDLYGNAIEFLDRYEILENIFPYIKEAKTIGK
FT                   CKYHVVNAYTHMEMTYRNFKDLISGRLSLNGIKDVLIDKLVQNFSLYDYIAISAFLHDI
FT                   GKFAAYKKENGQVSFTNHNELGARITEEALKKLGFPKEAIEIITTIIEGHMHPLRIFKA
FT                   GGMSQKKAIEDFFNKYKEIAPMIIAVSFCDVYATLSLKDDDNQEDAFKIFMENLIQEYR
FT                   TFI"
     atgaaggaaa ctatacagct tttaaaaagt tatatgaaga ataaagaaga taaaatatat        60
     atagttggtg aatatgttag agataagctt aaggattcct ccaaagagcc aaaaacactt       120
     gacatagttg ttgatggtaa tgaagcttgt cttataaaat atctagaagc ccacgagttt       180
     aagtttgata agttaaaaga taagcaaaga ggccataaga aaacaaaaga atcggaagaa       240
     ctgtatatat ggactaataa aggccaaaat atagaggagt atctacaggg agtagacttt       300
     actgtaaatg ccattgcgtt agatataaag gataataaaa tgattgatcc ttataatggt       360
     cgcagagata taaaaagtaa attagttaat gaagtgatgc aagagagcat aagtaaggca       420
     ccgataagaa taattactgc tataaagtta tctttagaaa atggaatgca tttaggtggt       480
     tttactgaag aacatataag attatataag gataagatcg atgaaagtga taaagatgaa       540
     ttgtatgaag ctttactatc gctttttagt aaagatttat atggtaatgc cattgagttc       600
     ttagatagat atgagatcct tgaaaatatt tttccatata taaaggaagc taaaactatc       660
     ggtaaatgca aatatcatgt agtaaatgct tatacacata tggagatgac ttataggaat       720
     tttaaagacc ttatatcagg cagattatct ttaaatggta taaaagatgt attgatagat       780
     aaacttgtac aaaatttctc actgtacgat tacatagcta tatcagcgtt tcttcatgat       840
     ataggaaagt ttgcagcata taaaaaagag aatgggcaag tatcctttac aaatcataat       900
     gaacttggag caaggataac agaagaggca cttaaaaagt taggctttcc taaagaagct       960
     atagaaatta ttactactat aatagaaggg catatgcatc ctcttaggat atttaaggct      1020
     ggtgggatgt cacagaaaaa agctatagaa gatttcttta ataagtataa agaaattgca      1080
     cctatgatta tagctgtttc gttttgtgat gtttatgcta ctctatctct taaagatgat      1140
     gataatcagg aagatgcttt taaaattttt atggagaatc ttattcagga atatagaact      1200
     tttatatag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page