(data stored in ACNUC7421 zone)

EMBL: CP002160.PE113

CP002160.PE113       Location/Qualifiers
FT   CDS_pept        189192..189659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN3"
FT                   /inference="similar to AA sequence:KEGG:Clos_2608"
FT                   /protein_id="ADL49904.1"
FT                   /translation="MRCEYIDKLINACAFVPDYKDNIGKVTKIYLKTGGCFVTRYSMRK
FT                   VIDDFCTINLTDINKLRKLSAELIGGKNLKPIYVRKGVVMIPIKTTKPLVDGDKCFAYV
FT                   NLHCIDDLYMDESIIRLNNGEEICYVESANAVKLRLAEGTILQNKVTLKGV"
     atgagatgtg aatatattga taagttaatt aatgcatgtg catttgtacc agattataaa        60
     gacaacatag gaaaagtaac aaagatatat ttaaagaccg gaggctgttt tgtaactcgc       120
     tattccatga gaaaagttat tgatgatttt tgtacaatta atcttacgga tataaataag       180
     ttaagaaaac ttagcgcaga gctcataggt ggtaaaaatt taaaacctat atacgtaaga       240
     aagggagttg ttatgattcc tataaaaact acaaaaccac tagttgatgg tgataagtgt       300
     tttgcatacg taaatctaca ctgtatagat gatttgtata tggatgaaag tataatacgg       360
     ttaaataatg gggaagagat atgttatgtt gaaagtgcca atgcagtaaa gcttagattg       420
     gcagagggta ctatattaca aaataaagtt acattaaaag gtgtataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page