(data stored in ACNUC7421 zone)

EMBL: CP002160.PE114

CP002160.PE114       Location/Qualifiers
FT   CDS_pept        189923..190516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0116"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   cno:NT01CX_0747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49905"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN4"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ADL49905.1"
FT                   /translation="MENKESILNDLLSISQNVIDSNIIPFSDLPEYDLFLSQVVDYLND
FT                   RFEGEDFTNNIVQNYVKNEVVSKPQDGKKRGYTKVHLTELVLLGHMRPILTSDEIKKVF
FT                   RLAFNDINDRTDDIIPWESAYKSFTEIQKNAFSDLQEKGLVDEVMIKELIKPFQLNEKE
FT                   TERIVVFLTVMTLIAQASAIKKLARKIIDEYSEE"
     atggaaaaca aggagtctat tttaaatgac ttattgagta tatcccaaaa tgtaattgat        60
     tccaatataa taccctttag tgatttaccg gaatatgatc tattcttatc acaagttgta       120
     gattatctaa atgatagatt tgaaggtgaa gattttacta ataatatagt tcaaaattat       180
     gttaaaaatg aagttgtatc aaaacctcaa gatggtaaga aaagaggtta tacaaaggtt       240
     catttaactg aactagtgct tttagggcac atgagaccaa ttttaacttc tgatgagatt       300
     aaaaaagtat ttagattggc atttaatgat attaatgata gaactgatga tataatccct       360
     tgggaaagtg cttacaaatc atttacagag atacagaaaa atgcatttag tgatttgcag       420
     gaaaagggac ttgtagatga agttatgata aaagagttaa taaagccatt ccaattaaat       480
     gaaaaagaaa cagaaagaat agttgtcttt ttaacagtta tgactttaat agctcaagct       540
     agtgcaataa aaaaattagc aagaaaaatc atagatgagt attcagagga atag             594
//

If you have problems or comments...

PBIL Back to PBIL home page