(data stored in ACNUC7421 zone)

EMBL: CP002160.PE117

CP002160.PE117       Location/Qualifiers
FT   CDS_pept        192762..193505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0119"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: cno:NT01CX_0777 peptidil-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49908"
FT                   /db_xref="GOA:D9SNN7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN7"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADL49908.1"
FT                   /translation="MDNKVLAVVKNKEITEQNINELIVRMPDQQRMYYDTEQGRARLLE
FT                   ELVSVEVFYNYALELKLDESPAFLEQLEGAKRQMLFPIAADEVTKDVEIADQDVADFYK
FT                   NNRELFKKPELATASHILVDSEEKAQEIKAEIEAGLSFADAAAKYSTCPSNQRGGDLGQ
FT                   FQKGQMVPEFEEVAFTLPINKLSDPVKTQFGYHLIKVTDFQPEMIQDFDEVQVAIKEKM
FT                   LQDRRQYKFLEKVDELKKLYNVEYK"
     atggataata aagtattagc agtggtaaaa aataaagaga taacagaaca aaatattaat        60
     gaattaatag taagaatgcc agaccaacaa agaatgtatt atgatacaga acaaggtaga       120
     gcaagattat tagaagaatt agtaagcgtt gaagtttttt ataactatgc tttagaactt       180
     aaattagatg aaagtcctgc atttttagaa caattagaag gtgctaaaag acaaatgcta       240
     ttcccaatag cagcagatga agtgacaaaa gatgtagaaa tagcagatca agatgtagct       300
     gatttctata aaaataatag agaattattt aaaaaaccag aattagctac agcaagtcat       360
     atattagttg attcagaaga aaaagcacaa gagattaaag cagagataga agctggtctt       420
     tcttttgcag atgccgcagc taaatattca acttgtccat caaatcaaag aggcggagat       480
     cttggtcaat tccaaaaagg ccaaatggtt cctgagtttg aggaagttgc attcactctt       540
     cctataaata agttaagtga tccagttaaa actcaatttg gatatcactt aataaaagtt       600
     actgatttcc aaccagagat gattcaagat tttgatgaag ttcaggtagc tataaaggaa       660
     aaaatgttac aagatagaag acaatataaa ttccttgaaa aagttgatga acttaagaaa       720
     ttatataatg tagagtataa ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page