(data stored in ACNUC7421 zone)

EMBL: CP002160.PE118

CP002160.PE118       Location/Qualifiers
FT   CDS_pept        complement(193679..194119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:415947 RNA binding motif protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN8"
FT                   /inference="similar to AA sequence:KEGG:415947"
FT                   /protein_id="ADL49909.1"
FT                   /translation="MGYKKDVDKDCFDYTIEDYDYDEMNDSDYTIKGKKDSRDKDCGCY
FT                   EYKKDKDYEDKDYDCYEYKKSKDYKKDKDYEDYEDNKEYGKYEEYEKCHEKPKKDKCKG
FT                   ETCCYGPYYEPYYVVKKCYRKYYIVKHCTWHRVPCCPKPRCK"
     atgggataca agaaagatgt agataaagat tgctttgatt acactattga agattatgat        60
     tatgatgaaa tgaatgatag tgattataca atcaaaggaa aaaaagactc tagagacaaa       120
     gattgtggct gctatgaata taaaaaagat aaagactatg aagacaaaga ttatgactgc       180
     tatgaatata aaaaaagtaa agactacaaa aaagataaag actatgaaga ctatgaagac       240
     aataaagaat acggaaaata tgaggaatat gaaaagtgtc atgaaaaacc taaaaaggac       300
     aaatgcaaag gtgaaacctg ttgctatggc ccttactatg aaccttatta tgtagtaaag       360
     aaatgctata gaaaatatta tatagtaaaa cattgtactt ggcatagagt tccttgttgc       420
     cctaaaccaa gatgtaaata g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page