(data stored in ACNUC7421 zone)

EMBL: CP002160.PE119

CP002160.PE119       Location/Qualifiers
FT   CDS_pept        199719..199844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49910"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49910.1"
FT                   /translation="MNIFLDIVRSQGNKFKRIALVISVHMYNNDKEFYNDNEETP"
     atgaatattt ttcttgatat cgttagatcc caaggcaata aatttaaaag aatagcttta        60
     gttatatctg tgcatatgta taataatgat aaagaatttt acaatgataa tgaagaaact       120
     ccataa                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page