(data stored in ACNUC7421 zone)

EMBL: CP002160.PE12

CP002160.PE12        Location/Qualifiers
FT   CDS_pept        20689..20910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0012"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   cac:CAC0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49803"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML8"
FT                   /inference="protein motif:PFAM:PF07892"
FT                   /protein_id="ADL49803.1"
FT                   /translation="MKEIFTTIVRIKGGNAKVCPVKSTEPVEKELFIELSKAISRVYIG
FT                   LPVKRGDIICKNILNTGVDIIATKNILE"
     atgaaagaga tatttaccac tattgtgaga attaaaggtg gcaatgcaaa agtatgccct        60
     gttaaatcaa cagaacctgt agaaaaggaa ctatttatag agctttcaaa ggcaatcagc       120
     agagtttata taggtttgcc agtcaaacga ggagatataa tttgcaaaaa tatattaaac       180
     actggcgttg atataatcgc aactaaaaat atattggaat ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page