(data stored in ACNUC7421 zone)

EMBL: CP002160.PE120

CP002160.PE120       Location/Qualifiers
FT   CDS_pept        200647..201429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0122"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   cbt:CLH_3304 chemotaxis protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49911"
FT                   /db_xref="GOA:D9SNP0"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP0"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADL49911.1"
FT                   /translation="MDIFTIVSLIFAFGSLIVGFLLEEGQLSALVQVSAFIIIFGGTFG
FT                   AVAVSFPGRIFKKFPKVLAIAFKKRDSKIGENIRYFKEISIRTRREGLLILEGEVTNDG
FT                   IDPFIKKGFQLAADGTEQSVIQGILETELEQMADRHDEGIEMFSAAGGYSPTMGIIGTV
FT                   MGLLQVVANLDDPLALGVKIAAAFMATLYGIAMANLFWLPIANKLKMLNKEEINEKQMI
FT                   IEAVLLIQQGSNTNSLVSKLEGYMLDDDKKSLLEDKQV"
     atggatattt ttacaattgt aagtttgatt tttgcctttg gttcgctaat tgtagggttc        60
     ttattggaag aaggacaact tagtgcatta gttcaagttt ctgcattcat aataatattt       120
     ggaggaacgt ttggagcagt agctgtatca tttccaggaa ggattttcaa gaagtttcct       180
     aaggtactag ctatagcgtt taagaaaagg gacagtaaga ttggagaaaa tataagatat       240
     tttaaagaga tatcaataag aactagaaga gaaggtcttc taatcctaga aggagaagtt       300
     acaaatgatg ggattgaccc atttataaaa aagggatttc agttagctgc cgatggaact       360
     gaacaatctg taattcaagg tattttagaa actgaattag agcaaatggc agatagacat       420
     gatgaaggaa tcgaaatgtt ctcagcagca ggtggttatt cccctacaat gggtatcatt       480
     ggtacagtaa tgggattact tcaagtagtt gcaaacttag atgatccttt agcgttgggt       540
     gttaagattg cagcagcatt tatggcgacc ttatatggta ttgctatggc taacttattc       600
     tggttaccaa ttgcaaataa attaaaaatg ttaaataaag aagaaatcaa tgaaaaacaa       660
     atgataatag aagctgtatt acttatacaa caaggatcta acacaaattc attagttagt       720
     aagcttgaag gttatatgct agatgatgat aaaaaatcat tattagaaga taagcaggta       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page