(data stored in ACNUC7421 zone)

EMBL: CP002160.PE124

CP002160.PE124       Location/Qualifiers
FT   CDS_pept        complement(204870..205337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0126"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: cpf:CPF_2616 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49915"
FT                   /db_xref="GOA:D9SNP4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADL49915.1"
FT                   /translation="MRIGMGYDVHKLVGGRDLIIGGVTIPYAKGLLGHSDADVLLHAIM
FT                   DSLLGAAALGDIGKHFPDTDAKYKGISSIKLLEEVGKLLKDNNFSIGNIDATIVAQAPK
FT                   MAPHITEMRKNISEALDISIDNINVKATTEEGLGFTGLGQGISSQSICLLV"
     atgagaattg gtatgggtta cgatgttcat aagttagtag gaggaaggga ccttattatc        60
     ggtggagtaa ccatcccata tgctaaaggc cttctaggac attctgacgc tgatgttctc       120
     cttcatgcaa taatggacag tttgcttgga gctgcagcct taggagatat aggaaagcat       180
     tttcctgata cagacgcaaa gtataaagga atatctagta taaaacttct tgaagaggtt       240
     gggaaattac ttaaagacaa taactttagt attggaaaca ttgatgcaac tattgtggcg       300
     caagccccaa aaatggcacc tcatataaca gaaatgagaa aaaacatcag tgaagccttg       360
     gatatatcta tagataacat aaatgtaaag gctactacag aagagggttt aggctttact       420
     ggcttagggc agggtatttc aagccaaagt atatgcctcc tagtttag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page