(data stored in ACNUC7421 zone)

EMBL: CP002160.PE126

CP002160.PE126       Location/Qualifiers
FT   CDS_pept        206087..206692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0128"
FT                   /product="sortase family protein"
FT                   /note="KEGG: cac:CAC0204 sortase; TIGRFAM: sortase family
FT                   protein; PFAM: peptidase C60 sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49917"
FT                   /db_xref="GOA:D9SNP6"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP6"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADL49917.1"
FT                   /translation="MEKKNKKNIWFIVGIILAVVGVIIILSAIYMNFKGKLENDKMISN
FT                   FEKKLEQVKDNNEKVEIKEQQDVIEEGTIGIMQIPKIGLKVAVGEGTDMETLKYAVGHF
FT                   KDTALPGELGNFAVAGHRSYTYNEFFNRLDEVTTGDKILVKTLKGTFTYEVTGTEVVEP
FT                   TQVEVLNKTDNATVTLVTCTPIRTATHRLIIKGVLVNN"
     ttggagaaaa aaaataaaaa aaatatttgg tttatagttg gaatcatttt agcagttgtc        60
     ggtgttatta tcatattatc agcaatctat atgaatttca aaggtaagct ggaaaatgac       120
     aaaatgattt ccaattttga aaaaaagttg gaacaggtta aggacaataa tgaaaaagtt       180
     gaaataaagg aacaacagga tgttatcgaa gaaggcacta tcggtataat gcaaattcct       240
     aaaattggtc ttaaggttgc agtcggtgaa ggaacagata tggaaacttt aaagtatgct       300
     gtaggacact ttaaagatac tgctttacct ggagaactag ggaactttgc tgttgctgga       360
     catagaagct atacttacaa tgagtttttt aataggctcg atgaagttac aactggtgat       420
     aaaatactcg ttaaaacctt aaagggtact tttacttatg aagttactgg aacagaggtt       480
     gttgagccta cacaggttga agtattaaac aaaactgata acgccacggt aacattagtc       540
     acatgcacac ctataagaac tgcgacacac agattaataa tcaaaggtgt acttgtgaat       600
     aactaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page