(data stored in ACNUC7421 zone)

EMBL: CP002160.PE127

CP002160.PE127       Location/Qualifiers
FT   CDS_pept        complement(207153..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49918"
FT                   /db_xref="GOA:D9SNP7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP7"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0725"
FT                   /protein_id="ADL49918.1"
FT                   /translation="MLVSGLVLKIRRKYVIALDSNGYVIKIKIGSLTPLIGEIYHGTFL
FT                   ETKPSGYYFRKYKTPVLIITFIITISLIICSYLYYTPTTTVYIEASAQVTLSINRYNKV
FT                   VKAIALNSEGDKLLTSVRVKGTTLDESLNILYDGAIKNRIIDQYFAEAKQIYRVNIDSE
FT                   ANIDITSFLNTIKSSPYIIHINNKGNVIYNSQYK"
     atgttagtta gcggcttagt actaaaaata cgcagaaaat atgttatagc tttggattca        60
     aatggttacg taattaaaat aaaaatagga tctctaacgc cattgattgg agaaatatat       120
     catggtacct ttcttgaaac aaagccatct ggctattatt tcagaaagta caagactcct       180
     gtattgatta ttacctttat aataacaatt tcgctaatta tatgctcata cctttactat       240
     acccctacta ctacagttta catagaagca tctgctcaag taactctttc tattaacagg       300
     tataacaagg ttgttaaagc tatagcgcta aattctgaag gtgataaact tttaacgtct       360
     gtacgtgtga aaggtacaac cctcgatgaa tctttaaata ttttatatga tggtgcaata       420
     aaaaatcgaa taatcgatca gtattttgca gaagctaaac aaatatatag agtgaatata       480
     gattcagaag ctaatataga tattacgtcc tttttaaata ctattaaaag ttcaccttat       540
     attatccaca taaataataa gggaaacgta atatataatt cacaatacaa gtaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page