(data stored in ACNUC7421 zone)

EMBL: CP002160.PE13

CP002160.PE13        Location/Qualifiers
FT   CDS_pept        21223..22503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: cbl:CLK_3156
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49804"
FT                   /db_xref="GOA:D9SML9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML9"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADL49804.1"
FT                   /translation="MLDLKRIRSNKDEIKAALSNRGEDFDLTVIDKVVELDESRRAILV
FT                   EVENKKNQRNTESALVPKLKKAGEDASEVLQRMKSLSDEIKELDDKVRAIDEEIEYIML
FT                   RIPNIPNPLVPDGATDEDNLEIKRWGEPRKFENEPKAHWDLGVDLKILDFERAGKVTGS
FT                   RFTFYRGLGARLERALISYFLDTHVDINGYTEIMPPLMANRNSMKGTGQLPKFEEDAFT
FT                   IQNNGYFLIPTAEVPVTNYYRDEILVGEELPIKHVAYSACFRSEAGSAGRDTRGLVRQH
FT                   QFNKVELVKFTKQEQSYEELDKLVKDAESILEGLGLPYRKVRICKGDLGFTAALKYDLE
FT                   VWMPSYNKYVEISSCSNFEDFQARRANIKYREDAKAKPQFVHTLNGSGLAVGRTFAAIL
FT                   ENYQNEDGSVTIPEVLRKYMGGVEVIK"
     atgttagatc ttaaaagaat aagaagcaat aaagatgaga ttaaagcagc tttaagcaac        60
     agaggtgaag attttgatct tactgttata gataaggtag ttgagcttga tgagtcaaga       120
     agagcaatct tagtagaagt agaaaacaaa aagaaccaaa gaaatacaga atcagcatta       180
     gtaccaaagc taaaaaaagc tggcgaagat gcttctgaag tgcttcaaag aatgaaatct       240
     ctatcagacg aaattaagga attagatgac aaagttagag caatagatga agaaatagag       300
     tacataatgc ttagaattcc aaacatacct aatccattag ttccagatgg ggcaacagat       360
     gaggataatc ttgaaattaa aagatgggga gaaccaagaa aatttgaaaa tgagccaaaa       420
     gcgcattggg atctaggtgt ggatctaaaa atattagatt ttgaaagagc tgggaaggtt       480
     actggttcaa gatttacttt ttatagaggt cttggtgcta gattagaaag agcactaatc       540
     agctatttct tagatacaca tgttgatata aatgggtata cagaaattat gcctccatta       600
     atggctaata gaaatagtat gaaaggtaca ggacaacttc ctaagtttga agaagatgct       660
     tttacaatac aaaataacgg atacttctta attcctacag cagaggtacc tgtaactaat       720
     tattatagag atgaaatttt agttggtgaa gaattaccta taaagcatgt agcttattca       780
     gcttgtttta gatctgaggc tggttcagct ggaagagata ctagaggact tgtaagacag       840
     catcaattta ataaagttga acttgttaag tttacaaaac aagaacaaag ttatgaagaa       900
     ttagataaac tagttaaaga cgcagaaagt atactagaag gacttggatt accatataga       960
     aaggtaagaa tatgcaaggg tgatttagga tttacagcgg ctttaaaata tgatttggaa      1020
     gtatggatgc caagttataa taaatatgta gagatatcaa gttgttcaaa ttttgaagat      1080
     ttccaagcta gaagagcaaa cataaaatat agagaagatg caaaagctaa accacaattt      1140
     gttcacacat taaatggatc tggtcttgca gtaggaagaa cttttgctgc tattcttgaa      1200
     aattatcaaa atgaagatgg cagtgtaaca attccagaag ttttaagaaa atacatgggt      1260
     ggagtagaag ttataaaata g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page