(data stored in ACNUC7421 zone)

EMBL: CP002160.PE131

CP002160.PE131       Location/Qualifiers
FT   CDS_pept        209991..210509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0133"
FT                   /product="spore maturation protein B"
FT                   /note="SpmB; KEGG: cac:CAC0470 spore maturation protein B
FT                   (gene SpmB)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49922"
FT                   /db_xref="GOA:D9SNQ1"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ1"
FT                   /inference="similar to AA sequence:KEGG:CAC0470"
FT                   /protein_id="ADL49922.1"
FT                   /translation="MSYIFASIIPILICGIVIYGIVHKVKVYEVFVEGAKDGLSISVKI
FT                   FPYLLAMLLSISIFRSSGAMDYLITFISPIVGLIGLPAEIVPLILIKPLSGSGALGVFA
FT                   EILKNYGPDTFIGLVASIIMGGTETIFYTITVYYGAINIKKIRHTLWAAVMADITAIIV
FT                   ALVIARFIY"
     atgagctaca tatttgcgtc tataatacct atactaattt gtggaattgt tatatatggg        60
     attgtacata aggtgaaggt ctatgaggtt tttgtagaag gtgctaagga cggactttca       120
     atatctgtaa aaatatttcc ataccttttg gcgatgcttt tgtccatatc tatatttaga       180
     agttctggag cgatggatta tcttattact ttcattagtc caatagtagg gcttataggg       240
     ctgccagctg aaatagttcc cttgattttg ataaagcctt tatctggtag tggagcgtta       300
     ggggtttttg cagaaatttt aaaaaattat gggccagaca cttttattgg acttgttgca       360
     tctattataa tgggaggtac agaaactatt ttttacacga taactgtata ttatggagct       420
     attaatataa aaaagattag gcatacttta tgggcggctg ttatggcgga tattacagca       480
     ataattgtag ctctggttat agcacgattt atttattga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page