(data stored in ACNUC7421 zone)

EMBL: CP002160.PE135

CP002160.PE135       Location/Qualifiers
FT   CDS_pept        211934..212383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_2065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49926"
FT                   /db_xref="GOA:D9SNQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ5"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_2065"
FT                   /protein_id="ADL49926.1"
FT                   /translation="MKLFKSKYDDERINSLIYKASFNTVVLLQIALLGDFIVRTLILNH
FT                   PLRESISSLIIFIIGAIYMCTCIIINGAYGTMVSENKFNLKRKRVYIYLIGSAFVAIMI
FT                   NITDGDDFYSKKGLLKFGFDFVAFFILTYFSSSALNKLLTNKKGR"
     atgaagttat ttaaaagtaa atatgatgat gaaagaataa attcattaat atataaagct        60
     agttttaata cagtagtttt attacagatt gctttactag gtgattttat tgttaggaca       120
     ttaattttaa atcatccttt aagagaatcc ataagtagtt taataatatt tataataggt       180
     gcaatatata tgtgtacatg cattattata aatggggcat atggaactat ggtaagcgaa       240
     aataaattta atttaaaaag aaaacgagta tacatatatt taattggctc agcttttgtt       300
     gctataatga ttaatataac tgatggagat gacttttatt ctaagaaagg attattgaag       360
     tttggttttg actttgttgc attctttatc ttgacttact tttcatcaag tgcgttgaat       420
     aaactgttga ctaataaaaa aggtaggtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page