(data stored in ACNUC7421 zone)

EMBL: CP002160.PE137

CP002160.PE137       Location/Qualifiers
FT   CDS_pept        212785..213543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0139"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   KEGG: HAD-superfamily subfamily IIA hydrolase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49928"
FT                   /db_xref="GOA:D9SNQ7"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ADL49928.1"
FT                   /translation="MKTKAIFFDLDGTLYFKGEAIEGAIETVNQLRDKGYICRFLTNTD
FT                   GSTPKTILDRLRNMGFNIQLEEIYTPITASIKFLERIEGARIYPLMLDEVVDEYKNFNI
FT                   GTEAVDYLVIGDCRDKISYDHLNTVFRMIGENTEIFVTQKGRYFYNADGKNIDTGAFAA
FT                   MFEYATGKVAKVLGKPSKDFFNILLEDLNLEAGQVLIIGDDITTDIVGANTIGAKGALV
FT                   KTGKYNDQRNLKVAEPDMILDSVVDLQKLL"
     atgaagacaa aggcaatttt tttcgattta gatggaacat tatatttcaa gggagaagca        60
     attgaggggg caatagaaac agtaaatcag ttaagagata aaggatatat ttgcaggttc       120
     ttgactaata ctgatggtag tactcctaag acaatattag atagattaag gaatatgggt       180
     tttaatatac agttagaaga aatttatact cctattactg catcgataaa atttctagaa       240
     agaattgaag gtgcaaggat atatccactg atgttagatg aagttgtaga tgaatataaa       300
     aactttaata taggtactga agcagtggat tatttggtta ttggtgattg cagagacaag       360
     attagttatg accatttaaa tacggtattt agaatgattg gggagaatac cgagatattt       420
     gtaacacaaa aaggaagata cttttataat gctgatggta agaacataga tacaggagct       480
     tttgcggcga tgtttgaata tgctacaggt aaggtggcta aggtattagg aaagccaagt       540
     aaggatttct ttaacatact tcttgaagat ttaaatttag aagctggaca agtgctgatt       600
     ataggagatg acataacaac tgatattgta ggggctaata caattggggc aaaaggtgct       660
     ttggttaaga cgggaaaata taatgatcaa aggaatctta aggttgcaga gcctgatatg       720
     atacttgact ctgtcgttga tttgcaaaaa ttattataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page