(data stored in ACNUC7421 zone)

EMBL: CP002160.PE138

CP002160.PE138       Location/Qualifiers
FT   CDS_pept        213959..215893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0140"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; KEGG: ter:Tery_1893
FT                   peptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49929"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ8"
FT                   /inference="protein motif:PFAM:PF04151"
FT                   /protein_id="ADL49929.1"
FT                   /translation="MMKKVLSLIICLLIFTSTNFSKVVYSAELYEIESNNDFSTANIVA
FT                   LGDITQGQILAANDYDFFKLQISYPQETNILLSNIPSGCDFDLYIYDSNGSSMASSTKG
FT                   SNADDSVTQTLNVGTYYIKVLRYSGSSSSFYKLSTLPIGTTPTIPSPDGNIYESEANND
FT                   FSNSNSIIFGSTIKGQILTSTDYDCFKLQLLYPRDTNILLNNIPSGCDFDLSLYDSNGF
FT                   KVDSSINRSNVDESITKTLAAGTYYIRIASATGNSDIYYNLSTSQTPPLAPSADGFVYE
FT                   NEANDDFSAANAIPFGSTVKGNIAASSNVDYFKLQLSSTENIKILLSNISTGCDYDLVL
FT                   FDFNNNYIASSKKGSNVDESITHSLAAGIYYIKISSYSGSSNNYYSLSTTLAGNAPMAP
FT                   YPDGGLYEREPNDSSSTAYPIEVGNSIKGQITSTSDNDLFKFQTYSTESLKIGLSDVPD
FT                   DCNFDLYLYDSNMNRIDSSTNGFGTVESIYKSLPAGTYYIKIISTLRSSTEYYNLSITD
FT                   VIPPTSTFHGGDIYEFDDSFSLATDMGEGSFTISEPNLNVSNDMDYFKFNLIQRSDVRV
FT                   VLTNPNYSSAKYRFDLYNSSYGNISYAYNVSEYTITLEPGTYYIKVHDNTAAPYTGLNY
FT                   QLQMTATGL"
     atgatgaaaa aagtcttatc cttaataata tgtctattaa ttttcacttc aactaatttt        60
     tcaaaggtag tttattctgc tgagttgtat gaaattgaaa gcaataatga cttttccact       120
     gcaaatatag ttgcgcttgg tgatattacg caaggccaaa ttttagcggc taatgattat       180
     gacttcttta agctgcaaat ctcatatcct caagaaacaa acattctact aagcaatata       240
     ccaagtggtt gcgatttcga cttgtacata tatgattcca atggaagtag catggcttcg       300
     tccacaaaag gaagtaatgc tgatgatagt gttacacaaa ctttaaacgt tggtacatat       360
     tatattaagg tgctccgtta cagtggtagt tcaagcagtt tctataagtt atcgacatta       420
     ccaattggta ctacgcctac aattccttct ccagatggga acatttatga aagtgaagcc       480
     aataatgatt tttctaattc aaactcaatt atctttggta gcactataaa gggccaaatt       540
     ttaacgtcta ctgattatga ttgctttaag ttacagttac tatatcctcg agatacaaat       600
     attcttctga acaacatacc aagtggctgt gattttgatt tatcactata cgattctaac       660
     gggtttaaag tggattcatc cataaaccgt agcaatgttg atgagagtat tacaaaaacc       720
     ttggcagctg gtacttacta tattagaata gccagtgcca ccggcaattc ggatatttat       780
     tataatttgt caacatcgca aacaccacca ctagcacctt ctgctgacgg gttcgtatat       840
     gaaaatgagg ctaatgatga tttttctgct gcaaatgcaa ttccttttgg cagtactgta       900
     aagggtaata tagcagcctc atccaatgtt gactacttta agttacaact atcatctact       960
     gagaatataa agattttatt aagtaatata tctactggtt gtgactatga cttagttctt      1020
     tttgatttca acaataatta tatagcttca tcaaaaaaag gaagtaatgt tgatgaaagt      1080
     attacacact ctttagctgc aggtatatac tatattaaaa tatcaagcta tagtggtagt      1140
     tccaacaact attacagttt gtcaacgact ttagctggga atgcaccaat ggctccttat      1200
     cctgatggcg gattgtatga aagagagcca aatgatagtt cttcaactgc atatccaatt      1260
     gaagttggta attctataaa aggtcaaatt acttcaactt ctgataatga tctttttaag      1320
     tttcaaacat attccactga gagtttgaaa attggactaa gtgatgttcc tgatgattgc      1380
     aactttgact tgtatttata tgattcaaac atgaatagaa tagattcttc aactaatggc      1440
     tttggaacag ttgaaagtat ttataaatct ctacctgctg gtacatatta tattaaaata      1500
     atcagcacac ttaggagttc cactgagtat tataacttat ctataacaga tgtaatcccg      1560
     ccgacatcaa cttttcacgg tggtgatatt tatgaatttg atgatagttt ttcacttgca      1620
     acggatatgg gtgaaggtag cttcacaatt tctgagccaa atctaaatgt atctaatgat      1680
     atggattact ttaagttcaa cttaatccag agatctgatg tacgagtagt tcttactaat      1740
     cctaattata gcagtgcaaa atatcgtttt gatctttata atagtagcta cggaaatata      1800
     tcttatgcat ataacgtaag cgagtatact attaccttag agcctggaac atattatata      1860
     aaggtccatg ataatacggc agcaccttat actggtctaa attatcaact acaaatgact      1920
     gcgactggtc tgtag                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page