(data stored in ACNUC7421 zone)

EMBL: CP002160.PE147

CP002160.PE147       Location/Qualifiers
FT   CDS_pept        232015..235080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0149"
FT                   /product="peptidase C1A papain"
FT                   /note="KEGG: mac:MA1513 hypothetical protein; PFAM:
FT                   peptidase C1A papain; SMART: peptidase C1A papain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49938"
FT                   /db_xref="GOA:D9SNR7"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR7"
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /protein_id="ADL49938.1"
FT                   /translation="MKKRKLFRTFLVLSIALPMIMASMASTAKATVNLSGESPKLQAFS
FT                   DSPSIFKGSTTLTVPIPEGRKLEATKNFGIVKPPIKLPNIKSRAYGVAGVYPTSYDLRT
FT                   YGKVTSVKDQSSSGSCWAFASYASLESKLLPGENRDFSENNLKNNSGFDFGPNNGGNSF
FT                   MSTAYMARWSGPINEADDPYNPTSITSPTNKSVQKHIQNVDFLPGKTTYLDNNFIKAAI
FT                   MSSGAVYTTFYYESCGYNATYKTYYDSFPWVDYTGNNHAVAIIGWDDNFDKNKFRDSYN
FT                   GAIPAGNGAYIVKNSWGSSWGQNGYFYVSYYDENFAMEENTVFNGPEATANYKSIYQYD
FT                   TLGFVEALGYNNTTAWMANVFSAPTAENLSAVSFYTVSPDCRYEVYVCSDYTGTTNLAS
FT                   NRILKATGTITSAGYHTIKLTSPVLLTGGKKFAVIVKLVTGGFGYPLAIEDAYPGYSGK
FT                   ATAVAGQSYVSSSGSSWMDLTTYDATANVCLKAFTTAVNKAPTVVSTVPTNLSINFNVT
FT                   NNILVRFSEPILAGTNYANITVKNPAGTVIPIAKAISSDTLTINPISNLANNTKYTVTI
FT                   PLGAVKDSTGLQLASQYTFSFTTVANIAPKVVSTTPANLSTNFAVGNNITVKFSEPILA
FT                   GTSYANVVVKNLAGTVIPVQKSISSDTLIINPTSNLIGNTKYTVTIPAGAVKDSTGLQL
FT                   VNPYAFSFTTGANTAPTVVSTTPANLSTNFAVGNNIVVKFSEALFAGSTYNSITVKNPS
FT                   GVVIPIQKALSANILVINPTINLAGNTKYTVTIPAGAFKDNEGLGFATTYTFSFTTGVN
FT                   TAPTVVSTTPANLATNFAVGNNIVVKFSEPVVVGTTYGSIIVKNPSGVVVAVQKAVSFD
FT                   SLIINPNSNLIGNTKYTVTIPAGAIKDSQGLGLATAYTFSFTTGANTAPTVVSTSPANL
FT                   ATKFPVTNNITVKFSEPLAVGTTYGSITVKNSSGVVIPIQKSISSDTLIINPNSNLAGS
FT                   TKYTVTIPAGAFKDNQGLGLAITYTFSFTTGV"
     gtgaaaaaaa gaaaactgtt tagaacattt ctcgtattaa gtatagcgct gccgatgata        60
     atggctagta tggccagtac agcaaaggct acagttaact tatctggcga aagtcctaaa       120
     ttgcaagcat tttcagacag tcccagtatt tttaaaggaa gtactacttt aacagtgccg       180
     ataccagaag gaagaaaact tgaggcaact aaaaactttg gaatagtgaa accacctatt       240
     aaattgccta atattaaatc aagagcttat ggtgttgcag gggtttatcc tacttcttat       300
     gatttgagaa cctatggtaa agtaacttct gtgaaagatc aatcttcttc ggggagctgt       360
     tgggcatttg cttcttatgc ttccttagag tcaaaacttc ttcctggtga aaatagggac       420
     ttttcagaga ataacttaaa aaataattct ggttttgatt ttggaccaaa caatggcgga       480
     aactctttta tgtcaacagc atatatggct agatggagtg ggccaataaa tgaagcagat       540
     gatccatata atccaacttc aattacatct ccaactaata aatcagttca aaaacacata       600
     cagaatgtag acttcttacc tggtaaaaca acttatctag ataataattt tataaaagct       660
     gccataatga gttcaggggc agtatatacc accttctatt atgagagttg tggttataat       720
     gcaacgtata aaacttacta tgattcattc ccatgggtag attacactgg aaataatcat       780
     gctgtagcta taattggatg ggatgataac ttcgataaga ataaatttag agattcatat       840
     aatggagcaa tacctgcagg aaacggagct tatattgtaa aaaatagttg gggttcttct       900
     tggggacaga acggatattt ctacgtatcc tattatgatg aaaattttgc tatggaagaa       960
     aatacagtat ttaatggtcc tgaagctaca gcaaattata aatcaatata tcaatatgat      1020
     actttaggtt ttgtagaagc actaggatac aataatacta ctgcttggat ggcgaacgtt      1080
     ttttcagcac caaccgctga aaatttatca gcagtaagtt tttatacagt atctcctgat      1140
     tgcagatacg aagtgtatgt atgcagcgat tatactggaa caacaaactt agcttctaac      1200
     cgtatattaa aagctactgg aactataacc tctgcaggtt atcatactat taagttaact      1260
     tcgccagtgc tattaacggg aggcaaaaaa tttgcggtaa ttgtaaaatt ggttacaggt      1320
     ggttttggtt atccgctagc tatagaggat gcttatcctg gatattcagg taaagctact      1380
     gccgttgctg gacaaagtta tgtaagtagt tcaggttcaa gttggatgga tttaaccaca      1440
     tatgatgcta ctgcaaatgt atgtctaaag gcattcacca cagctgtaaa caaagctcca      1500
     acagttgtaa gcacagtacc tacaaatcta tctattaatt ttaatgttac aaataatata      1560
     ttagtgaggt ttagtgaacc gatattggct ggaacaaatt acgctaatat aacagttaag      1620
     aaccctgctg gaacagttat tccaattgca aaagcaataa gttcagatac tttaactata      1680
     aatccaatta gcaatttagc taataataca aaatatacag ttacaattcc tcttggagca      1740
     gttaaggata gtactggact tcagctagct agtcaatata cctttagttt tactacagta      1800
     gccaatattg caccaaaggt tgtaagtact acgccagcaa atctatctac taactttgcc      1860
     gttggaaata atataactgt gaagtttagt gagccgatat tagctggaac aagttatgca      1920
     aatgtagtag ttaaaaacct agctggaaca gttattccgg ttcaaaaatc aataagttca      1980
     gatacgttaa ttataaaccc aactagtaac ttaattggta atacaaaata tactgttaca      2040
     attcctgctg gagcagttaa ggatagtact ggacttcagc tagttaatcc atatgccttt      2100
     agcttcacta ctggagcaaa tacagcacca acagttgtaa gcaccacacc agcaaattta      2160
     tctactaact ttgcagtagg taataatata gttgtgaagt ttagtgaggc attatttgca      2220
     ggatcaactt ataatagcat aaccgtgaaa aatccaagtg gagtagttat tccaatacaa      2280
     aaagctttaa gtgcaaatat tttagttata aatccaacaa ttaatttggc tggaaataca      2340
     aaatatactg ttacaattcc tgctggagca tttaaagaca atgagggatt aggctttgct      2400
     accacataca cctttagttt cactacaggg gtgaatacag caccaacagt tgtaagcact      2460
     acaccagcta atttagctac taactttgca gtaggcaata atatagttgt gaagtttagt      2520
     gaaccagttg ttgtaggaac aacttacgga agtataattg tgaagaaccc aagtggagta      2580
     gtggttgcag tacaaaaagc tgtaagtttt gatagtttaa ttataaatcc aaatagtaac      2640
     ttgataggga acacaaaata tactgttaca attcctgctg gggcaataaa agatagtcaa      2700
     ggattagggt tagctactgc atataccttt agctttacta caggggcaaa tacagcacca      2760
     acggttgtaa gtacttcgcc agctaattta gctactaaat ttccagtaac caataatata      2820
     acagtgaagt ttagtgaacc acttgcggta ggaaccactt atggaagtat aactgtgaag      2880
     aactcaagtg gagtagtgat tccgatacaa aaatcaataa gttcagatac tttaattata      2940
     aatccaaaca gtaatttagc aggcagtaca aaatatactg ttacaattcc tgctggagca      3000
     tttaaagata atcaaggttt aggcttagct atcacataca ccttcagctt tactactgga      3060
     gtataa                                                                 3066
//

If you have problems or comments...

PBIL Back to PBIL home page