(data stored in ACNUC7421 zone)

EMBL: CP002160.PE15

CP002160.PE15        Location/Qualifiers
FT   CDS_pept        complement(24327..24701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49806"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM1"
FT                   /inference="similar to AA sequence:KEGG:lin0130"
FT                   /protein_id="ADL49806.1"
FT                   /translation="MRKFFKFIITSIFIIIAIDILSRTATLNWSYLKVNDELYVLCTYN
FT                   IQNLDETDKFTKIGTIESKTNIFIKPIFNYSSNSFRKGSEVYKTDDNQIAVKQNNKFYV
FT                   LSSTQSEGWGNGIMVNPYLD"
     atgagaaagt tctttaaatt tataattaca tctattttca taataattgc tatagatatc        60
     ctatctagaa ctgcaacttt gaattggtca tacttaaaag taaacgatga actatatgta       120
     ctttgcacat ataatattca gaatctcgat gaaactgata aatttacgaa aattggtaca       180
     atcgagagta aaacaaatat tttcattaag cctattttca attattcatc aaattctttt       240
     agaaaaggat ctgaagtcta taaaactgat gataaccaaa ttgcagtaaa gcaaaataat       300
     aaattttatg tcctctcttc aacacagtct gaaggatggg ggaatggcat tatggttaat       360
     ccttatttag attaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page