(data stored in ACNUC7421 zone)

EMBL: CP002160.PE151

CP002160.PE151       Location/Qualifiers
FT   CDS_pept        240833..242020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0154"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cpy:Cphy_0029 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49942"
FT                   /db_xref="GOA:D9SNS1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL49942.1"
FT                   /translation="MDWQKCMNQALDYIENNLACDIDYCAAAKIMNCSEWEFRRIFSFL
FT                   AQIPLSEYIRRRRLVMAAIDIKKGEKIIDVAIRYGYESQAAFSRAFSRFHGIAPSLARD
FT                   EGVDLKAFPRLTFKLILMEGNCMKKNPNHRTNIIGAGEVGYAISVEMDENNIHKTNSSF
FT                   WDTKGNEVIGTTALPKYGAFVSEEKCHLFGDVSGKRLLEIGCGTGHSLKYHGDRNASEL
FT                   WGIDISENQIEKAKEYLSLCGFSAKLICSPMEEDCGIPVDYFDYVYSIYGVGWTTDLES
FT                   TFSRIASYIKKDGVFIFSWSHPIHKCVAIENEMLSFKKSYFDESWYSVSLEGGAISLSD
FT                   RKLSTYINALAKAGFIIDEMIEESDDDIIQLDKDSDFAKKAKMLPVTFVIKARKL"
     atggattggc agaagtgtat gaatcaagca cttgattata ttgaaaataa tctagcttgt        60
     gatatcgatt attgtgcagc ggcaaagatc atgaactgct cggagtggga atttcgacga       120
     attttttctt tcttagctca aattccattg tccgaatata ttcgccggag acggctggtt       180
     atggctgcaa tagatattaa aaagggcgaa aaaataattg atgttgctat tcgctatgga       240
     tatgaatctc aagcagcttt ttcaagagca ttcagtcgat ttcatggaat agcgccatct       300
     ttggctcgag acgaaggggt agatctaaaa gcatttccac gcctgacctt taagttgata       360
     ttaatggagg gaaactgtat gaaaaagaat cctaatcaca gaactaacat tataggtgct       420
     ggtgaagttg gttatgctat ttctgttgaa atggacgaga ataatattca taaaactaac       480
     agttcgtttt gggacactaa aggtaacgag gtcataggga caacagcact tcctaaatat       540
     ggagcatttg tttcggagga aaagtgtcat ctttttggtg atgtatcagg gaaaaggttg       600
     ctagaaatag gttgcggaac tggacattct ctaaaatatc acggagacag aaacgcttct       660
     gaactatggg gcatagatat ttctgaaaat caaatagaaa aggctaagga atatttatca       720
     ttgtgcggtt tttctgcaaa gttgatctgt tcaccaatgg aagaagactg tggaatacct       780
     gtagattatt ttgactatgt ttattcgatt tacggtgtgg gttggactac tgaccttgaa       840
     agtacttttt ccaggattgc ttcttacata aaaaaagatg gcgtatttat ttttagttgg       900
     tctcacccaa tacataaatg cgttgctatt gaaaatgaga tgctctcttt taagaaaagt       960
     tattttgatg aatcttggta ttctgtatct cttgaaggag gtgcaatatc tttatcggat      1020
     cgcaaactat caacttatat caatgcatta gcaaaagcgg gatttatcat tgatgaaatg      1080
     attgaagaat ctgatgatga tattattcaa ttagataagg acagcgactt tgctaaaaaa      1140
     gccaaaatgc tccctgtaac atttgtaatt aaagcaagaa aattatag                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page