(data stored in ACNUC7421 zone)

EMBL: CP002160.PE153

CP002160.PE153       Location/Qualifiers
FT   CDS_pept        242742..243257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0156"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hor:Hore_00330 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49944"
FT                   /db_xref="GOA:D9SNS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL49944.1"
FT                   /translation="MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI
FT                   MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG
FT                   KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD
FT                   LQMVCDVD"
     atgattaagt ttcagttgct aacaaaggaa aacatggctg aaaatgcact tgataattat        60
     gacaggctac aaaatgtgcg aagagtttac aggaaaattg acagtgagta tatgcttgtt       120
     gaagatgttg gtattatgga ttggagtttt gagagaaaac aggctgttgc aaaagcactt       180
     attagtgatg actatattac atttggtgca attagagaag atgaaatagt gggatttgct       240
     tcgatagaaa agcaattaca gggaaaatat atagtattag atatgatgca agtttcacga       300
     aaatatcgcg gtaaggggat gggaagaact ttatttcagc tagtgaaaga aaaagcaaag       360
     gaaatgggag caaaacagct atatatttca gcatgtgcat cagaagaaac cattgaattt       420
     tacaaatcaa tggggtgtaa aataactgac aatccaatca aaaaaattgc agaagatgag       480
     ccctttgatt tacaaatggt ttgcgatgtt gattaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page