(data stored in ACNUC7421 zone)

EMBL: CP002160.PE160

CP002160.PE160       Location/Qualifiers
FT   CDS_pept        complement(249634..250218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_1698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49951"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT0"
FT                   /inference="similar to AA sequence:KEGG:Fjoh_1698"
FT                   /protein_id="ADL49951.1"
FT                   /translation="MKIKRIIMPIVLIFTYTISAFSNVIVYANPDVSANPDVSYFENAL
FT                   SELTMSDIVSYLEKNISELEIQKNKVMIEEQRNSIEVEISGYREILTTIKSKNITDEVL
FT                   NKSKDLIFNNDPNNSIENLLKDGQAVAKNTFNKNIVTASGLRTPSMLGDPIYMSVYILL
FT                   VAAIAVGDTQYGYHFAARLLAHAMDNNTKLG"
     atgaaaataa aaagaattat aatgccaatt gttcttattt ttacatatac aatatcagct        60
     tttagcaatg tgattgtata tgctaatcca gatgtaagtg ctaatccaga cgtcagttat       120
     tttgaaaatg ctctaagtga attaactatg agtgatattg tatcatatct agaaaaaaat       180
     atatcagaat tagaaataca aaaaaataaa gtaatgatag aagaacaaag aaatagtatt       240
     gaagttgaaa tcagcggata tagagaaata ttaactacta taaaaagtaa aaatataact       300
     gatgaagtac ttaataaaag taaagattta atatttaata acgacccaaa taattcaata       360
     gaaaatctac taaaagacgg acaggctgtt gctaagaata cttttaataa aaatattgtg       420
     acggcttctg gacttcgtac accaagcatg cttggggatc cgatatatat gtcagtatat       480
     atcttattgg ttgcagctat agctgtaggt gatactcagt atggatatca ttttgccgca       540
     aggttgcttg cgcatgcaat ggataacaat actaaattag gataa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page