(data stored in ACNUC7421 zone)

EMBL: CP002160.PE162

CP002160.PE162       Location/Qualifiers
FT   CDS_pept        complement(251023..251379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0165"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: cbf:CLI_3306 putative transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49953"
FT                   /db_xref="GOA:D9SNT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL49953.1"
FT                   /translation="MLKDKIKELRKEMGLTQEEFASKLEISRSYYCDIERGRLKGTNVK
FT                   IISKLSDVTGKPMEYFLDKDVEVKQYDILDSALNMLIEKGLINSDGEITDETSRNIVME
FT                   ILKKEIQLKIKSRE"
     ttgttaaaag ataaaatcaa agaacttaga aaggaaatgg gcctaactca agaggagttt        60
     gctagtaagc ttgagataag cagaagctac tactgtgata tagaaagagg tcgattaaaa       120
     ggcactaacg ttaagataat ttcaaagtta tccgatgtta caggaaagcc tatggaatat       180
     ttccttgata aggatgttga ggttaaacaa tatgatatat tagattccgc cttaaacatg       240
     ctaatagaaa aaggcctaat aaacagcgac ggcgaaataa cagacgaaac ttcaagaaat       300
     attgttatgg agatcttaaa aaaagaaatt caacttaaaa taaaaagcag ggagtaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page