(data stored in ACNUC7421 zone)

EMBL: CP002160.PE163

CP002160.PE163       Location/Qualifiers
FT   CDS_pept        251573..251773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0166"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: deh:cbdb_B6 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49954"
FT                   /db_xref="GOA:D9SNT3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL49954.1"
FT                   /translation="MLKELRINKGITCTFVAKKLKISRDRLRRIEEGEVMLPAEFVPVL
FT                   AELYGVTYEELINRRAQEWKK"
     atgttgaagg agttaagaat aaataaagga ataacttgca cttttgtggc taaaaagcta        60
     aagataagca gagatagatt aagacgtatt gaggaagggg aagtaatgct tcctgcagag       120
     tttgttcccg ttctagcaga attatatgga gtaacttatg aagagctgat aaatagaagg       180
     gctcaggagt ggaagaaata g                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page