(data stored in ACNUC7421 zone)

EMBL: CP002160.PE164

CP002160.PE164       Location/Qualifiers
FT   CDS_pept        251933..252145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmh:Mmah_1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49955"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT4"
FT                   /inference="similar to AA sequence:KEGG:Mmah_1264"
FT                   /protein_id="ADL49955.1"
FT                   /translation="MKVLSISSSNCLLSRSPYGVDVNGKSISELINEKLPEELVNYQKY
FT                   SAKINVSIEIWDEDDLNITTTGYEL"
     atgaaagtat tatcaataag ctcaagtaat tgcttattaa gtagaagtcc atatggtgta        60
     gatgttaacg gaaagtccat aagtgaattg attaatgaga aacttccaga ggaattggtg       120
     aactatcaga agtattcagc aaaaattaac gtgagcatag aaatttggga tgaagatgat       180
     ttaaatataa ccacaacagg ttatgaactt taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page