(data stored in ACNUC7421 zone)

EMBL: CP002160.PE166

CP002160.PE166       Location/Qualifiers
FT   CDS_pept        255724..256431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49957"
FT                   /db_xref="InterPro:IPR007927"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT6"
FT                   /inference="similar to AA sequence:KEGG:CLK_1341"
FT                   /protein_id="ADL49957.1"
FT                   /translation="MRENIMRVNNIEIDNNIKRASKITIERNMDIENSIKMENNIRKDR
FT                   SIKIENDIKKEINIKAQNTNKKDSKINIDNNIDIDDNIKIKNTVKKESKIKRTENRLYA
FT                   YKDIDILNQLTEIKIKKLKDDVSIKAMTYEEKFSTNRFNSNVENEVIRREEFVESKIEE
FT                   LRKEKESRLNEKALIDKVLELLDVEEKRLVGLRYFSKPTRSWTSIAQELNQSVDNCIKV
FT                   RRRVIEKLDGFLF"
     atgagagaga acattatgag agtgaataac attgagatag ataataacat taagagagcg        60
     agtaagatta ctatagagag aaacatggat atagagaata gcattaagat ggaaaataac       120
     attaggaaag atagaagcat taagatagaa aatgacatta agaaagagat taacattaag       180
     gcacagaata ccaataagaa agatagtaag attaatatag ataataacat tgatatagat       240
     gataacatta agataaagaa taccgttaag aaagaaagta aaatcaaaag aacagaaaat       300
     agactttatg catacaagga catagatata ttaaaccaat tgacggagat aaagataaaa       360
     aagctaaagg atgatgtatc cattaaggct atgacttatg aagaaaaatt ttctacaaac       420
     aggtttaatt ccaatgtaga aaatgaagta atcagaagag aagagtttgt tgaaagtaag       480
     atagaggagc ttagaaaaga aaaggaaagc agattaaatg aaaaggcttt aatagataag       540
     gtgctggagc ttttggatgt tgaggaaaaa agattagttg ggcttcgcta ttttagtaag       600
     cctacaagaa gttggacgag cattgctcag gaacttaatc aatcggtgga taattgtatt       660
     aaggtgagga gaagggttat tgagaagttg gatgggtttt tgttttag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page