(data stored in ACNUC7421 zone)

EMBL: CP002160.PE168

CP002160.PE168       Location/Qualifiers
FT   CDS_pept        258517..258861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0337 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49959"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT8"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0337"
FT                   /protein_id="ADL49959.1"
FT                   /translation="MPMFIPESLLQKEKFTGDKATYTIESLMHDGTLLDLLLDSGLSIY
FT                   AMPPDLTTEEIRKTKMFSRVKAVEIILWLKQNQNIDKWIVFHDIHLHNEDLAIRQVRTN
FT                   AEIGLTEKRC"
     atgccaatgt ttataccaga atcattattg caaaaagaaa agtttacagg agataaggca        60
     acatatacaa ttgaaagctt aatgcatgat ggaacattac ttgatttgtt attagattct       120
     ggtttaagca tttatgcaat gcccccagac ctaactactg aagaaatcag aaaaactaaa       180
     atgttcagta gggtcaaagc agtggagata attttatggt taaagcagaa tcaaaacatt       240
     gacaagtgga tagttttcca tgatatacat ttgcataatg aagatttagc gattagacaa       300
     gtgcgaacta atgcagagat aggacttaca gaaaaaagat gttga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page