(data stored in ACNUC7421 zone)

EMBL: CP002160.PE169

CP002160.PE169       Location/Qualifiers
FT   CDS_pept        259408..260373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0173"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cbf:CLI_0804 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49960"
FT                   /db_xref="GOA:D9SNT9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL49960.1"
FT                   /translation="MYEWQKQIQIIVDEIDKCIKNYNDEALTLRFLSRRLGYSEFYTTR
FT                   KFKEISGMQFRDYLRHRKLAFALKEVRDSEKSLLDIAFDYGFSSHEAFTRAFKGTYGVI
FT                   PSEYRKKPKPVILRTKINSFDRYFLGLGEIGMIKSTDGVKIYFVTIPAHKFLHIKNYES
FT                   NGYWDFWQKQSLIPGQDCETICGLLDSIKGKLDDDGGSESNSSSGQIMAYINDPDGRLC
FT                   DWGIPRTECYGTRLPFDYKGQVPPQMLMIDVPEAEYIVFEHGPFDYEQENRSVEEKIEK
FT                   AMATFDFADTGYCFDTSPGRIIYFYHDPERFWKYIRPVRK"
     atgtacgagt ggcagaagca aattcaaata atcgttgatg aaattgataa atgtattaaa        60
     aattataatg atgaagcctt aacactacgt tttctttctc gtaggctggg ttattccgaa       120
     ttttatacaa cgagaaaatt caaagaaata tcgggtatgc aatttaggga ttatctgcga       180
     catagaaaat tagcctttgc attaaaagag gtaagggata gtgaaaaaag ccttttagat       240
     attgcttttg attatgggtt ttcatcacat gaagcattta ccagagcttt taagggtaca       300
     tatggtgtaa ttccaagtga ataccgaaaa aaacctaagc ctgtcattct tcgtacaaaa       360
     ataaactcct tcgatcgcta ctttttagga ttgggagaga ttgggatgat aaaatctaca       420
     gatggtgtta aaatttattt tgtaaccatt cccgcacaca aatttttgca cataaaaaac       480
     tatgagagta atgggtattg ggatttttgg caaaagcaaa gtcttattcc gggacaggac       540
     tgcgaaacaa tttgcggctt actcgatagt atcaagggca aattggatga tgatggtggg       600
     agcgaatcta acagcagcag cggtcagatt atggcgtaca ttaatgaccc agacggcaga       660
     ctctgtgatt ggggtattcc acgtacagag tgttatggta cacgtcttcc ttttgattac       720
     aaaggccaag taccaccgca aatgcttatg attgatgttc cagaagccga gtatattgtt       780
     tttgaacatg ggccattcga ctatgagcag gaaaatcgta gcgtagagga aaagattgaa       840
     aaggcaatgg caacttttga ttttgcagac accggttact gctttgatac ttcccctggt       900
     agaataattt atttttatca tgatccagag cggttttgga aatatataag accagtgagg       960
     aagtag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page