(data stored in ACNUC7421 zone)

EMBL: CP002160.PE17

CP002160.PE17        Location/Qualifiers
FT   CDS_pept        28468..29481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0017"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family"
FT                   /note="KEGG: cpi:Cpin_2864 phytanoyl-CoA dioxygenase (PhyH)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49808"
FT                   /db_xref="GOA:D9SMM3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM3"
FT                   /inference="similar to AA sequence:KEGG:Cpin_2864"
FT                   /protein_id="ADL49808.1"
FT                   /translation="MDNYREKLKKITETLLKDEDDYGEIKKATDDLYDVFVAVSDLKED
FT                   DASCREDVYLSKGKAIGTVWAAMCIKEFMRTKRFIKGVFLAIKEAQKKFKDTQIHILYA
FT                   GTGPFATLILPLTTMFSSEEIKVTLLEINSESIKNLKTVISVLGAASYIEEIVQCDATT
FT                   YKVNKDKNVHMIVTETMQRALKKEPQVSITLNLVPQMIEGGILVPQNVTVSAALIDPKR
FT                   DLDRIMGIEGADEDFCYMLGKVFELTKDTTVVENKEGYKFPEIEIQIPMNIERRFRSLN
FT                   LLTDIQVFGEEKLTYLQCSLNLPQKLMYIEWEIDNLEKFIFEYIVNETPGFMFRKI"
     atggataatt atagagagaa gttgaagaaa atcacagaaa ctttattaaa agatgaagat        60
     gattatggtg aaataaaaaa ggctacagat gatttatatg atgtttttgt agctgtgtcg       120
     gatttaaagg aagatgatgc aagttgcaga gaggatgttt atctttctaa aggaaaagca       180
     ataggaacag tttgggcggc aatgtgtata aaagaattta tgaggactaa aagatttatc       240
     aaaggtgtat ttcttgcaat aaaagaagct caaaaaaaat tcaaagatac acaaattcat       300
     atattatatg ctggaactgg gccttttgct actttaatat taccattgac tactatgttt       360
     tctagtgaag aaattaaggt tactttactt gaaataaatt ctgaaagtat taaaaatctt       420
     aagacggtta ttagtgtttt gggagctgca agttatatag aagaaattgt tcaatgtgat       480
     gcaaccacat ataaagtaaa taaggacaag aatgttcata tgattgttac ggagactatg       540
     cagagggcac ttaagaagga acctcaggtt tccatcactt taaatttagt tccgcagatg       600
     attgaaggtg gtatattagt accacagaat gtaacagtat ctgcagcatt aatagacccc       660
     aagagagatt tagatagaat tatggggatt gaaggtgccg acgaagattt ttgctatatg       720
     ctaggcaaag tatttgaact aactaaggat acaacggtag tagaaaataa agagggatat       780
     aaatttccag agattgaaat tcagattcca atgaatatag aaagaagatt tagaagttta       840
     aatttgctta cggatataca ggtttttgga gaggaaaaat tgacatattt gcaatgctca       900
     ttaaacttac ctcaaaagct tatgtacata gagtgggaaa tcgataattt agaaaaattt       960
     atatttgaat acatagtaaa cgaaactcca ggatttatgt ttcgaaagat ataa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page