(data stored in ACNUC7421 zone)

EMBL: CP002160.PE170

CP002160.PE170       Location/Qualifiers
FT   CDS_pept        260721..260981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_3270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49961"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU0"
FT                   /inference="similar to AA sequence:KEGG:Cphy_3270"
FT                   /protein_id="ADL49961.1"
FT                   /translation="MEEFFKTIEEKIRKSGYPGEVSGEEIYTEISDEAEDQEEGSYLFM
FT                   KKQHDDITFEYRVDILEDNINLATLTIHTSERKYFIDFDAE"
     atggaagagt tttttaaaac aatagaggaa aagataagaa agtcaggata tcctggagaa        60
     gtcagtggcg aagaaatcta cactgaaata agtgatgagg ccgaggatca agaagaagga       120
     agttacttat ttatgaaaaa acaacatgat gatatcacgt ttgaatacag agtagatatt       180
     ttagaggaca atattaattt agcaacccta acgatacata catcagagag aaaatacttt       240
     attgattttg acgctgaata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page