(data stored in ACNUC7421 zone)

EMBL: CP002160.PE172

CP002160.PE172       Location/Qualifiers
FT   CDS_pept        complement(262518..263027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0176"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: asu:Asuc_0075
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49963"
FT                   /db_xref="GOA:D9SNU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL49963.1"
FT                   /translation="MIERTNASNIFVCECLQAALLRLLKTKPLENISILELVKIAGVSR
FT                   NSFYRNYNNLEEIIGEYLMKESQKWWDSYSKSEDKNLTKCLFEHFITLKDIISALYQSN
FT                   HSHLMMQHIFQCTISGKSCSAQESYQRAIIAGSTWGLFDEWVKRGMKDSPEEMSRFLES
FT                   GWHERT"
     atgatagaac gcacaaatgc atcaaatata tttgtatgtg aatgtctaca agccgcatta        60
     ctgcgattac taaaaacaaa accactagaa aatataagta tcttagagct agtaaagatt       120
     gccggtgtca gccgaaattc tttctatcgc aactataata acttggagga aattataggt       180
     gaatatctta tgaaagaatc ccagaagtgg tgggattctt atagcaagtc agaagacaaa       240
     aatcttacaa aatgtctatt tgagcatttt ataacattaa aagatattat ctcagcactc       300
     taccagtcga accattctca tctgatgatg caacatattt ttcaatgcac tatttccggc       360
     aaatcctgtt ctgcacaaga atcctatcaa cgagctatca ttgctgggag tacttgggga       420
     ttatttgatg aatgggtaaa acgtggcatg aaggactcac cagaagaaat gagccgcttt       480
     ctagaaagtg gatggcatga acgaacttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page