(data stored in ACNUC7421 zone)

EMBL: CP002160.PE175

CP002160.PE175       Location/Qualifiers
FT   CDS_pept        265067..265414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0181"
FT                   /product="uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: uncharacterized conserved protein UCP029876;
FT                   KEGG: gym:GYMC10_3365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49966"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU5"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADL49966.1"
FT                   /translation="MSFWGKITGSDITKEMKVFESRAKKLPTDYQVAWEKISANLWSYS
FT                   DFTGRNLMPILDGVLGMLEETAADGESVQEVLGDDIKGFCSALVGEEGAKSFRDKWRKQ
FT                   LNDNIAKKLGK"
     atgagttttt ggggaaaaat tacgggaagt gacatcacta aagaaatgaa agtttttgaa        60
     tcgcgagcca aaaagctacc gactgattat caagtggcat gggaaaaaat tagtgctaat       120
     ctttggtcat actcagattt caccggtcgc aacctcatgc caattcttga cggtgtactt       180
     ggcatgctcg aagaaacggc tgcggacggt gagagtgtac aagaggtttt gggtgacgat       240
     atcaaaggat tctgttcagc actggttggc gaagaagggg caaagtcttt tcgtgataaa       300
     tggcgtaaac aacttaatga taatatagct aaaaaattag gtaaatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page