(data stored in ACNUC7421 zone)

EMBL: CP002160.PE177

CP002160.PE177       Location/Qualifiers
FT   CDS_pept        266093..266533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0183"
FT                   /product="transcription activator effector binding"
FT                   /note="KEGG: cac:CAC3493 transcriptional regulator; PFAM:
FT                   transcription activator effector binding; SMART:
FT                   transcription activator effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49968"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU7"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49968.1"
FT                   /translation="MKYEIVNLQEKIVVGVSAITGNNDPNMGKIIGGLWEKLYQGGINE
FT                   MITNKVNEYAIGLYSNYEDDKYLVTVGNEVCKAESEGLTIKKIPVGKYAKFSIEGHMEK
FT                   AVAEAWNKIWQMDLDRSYEADFEEYLNSDFNNCKVDIYISLK"
     atgaagtacg aaattgtaaa tttacaagaa aaaatagtgg taggagttag tgctattaca        60
     ggtaataatg atcctaatat gggcaaaatt attggaggtc tttgggaaaa gttatatcaa       120
     ggtggcatta atgaaatgat aacaaataag gtaaatgaat atgccatagg actttattcg       180
     aattatgaag atgataagta tttagttaca gtaggaaatg aggtatgtaa ggctgaaagt       240
     gaaggactta caataaagaa aattcctgta gggaaatatg ctaagttttc tattgaagga       300
     catatggaaa aagcagttgc agaagcttgg aataaaattt ggcaaatgga tttagataga       360
     agttatgaag ctgattttga agaatattta aattcagatt ttaataattg taaggttgat       420
     atttatattt cattgaagta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page