(data stored in ACNUC7421 zone)

EMBL: CP002160.PE178

CP002160.PE178       Location/Qualifiers
FT   CDS_pept        266550..267446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0184"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: cac:CAC3492
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49969"
FT                   /db_xref="GOA:D9SNU8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADL49969.1"
FT                   /translation="MLEGSYDYMHEVIAKGILSSNNGMNIYRGCTHGCIYCDARSLCYG
FT                   MDHIFEDIEIKANVVQLLEDTLKRKRKKCMIGTGAMSDPYIQLEEKLQNTRRCLEIIDK
FT                   YGFGLAIQTKSNRILRDLDLLKSINSKSKCVVQMTLTTYDEELCKLIEPNVSTTKERFE
FT                   VLKIMRDNKIPTVVWLSPLLPYINDTEENIRGILDYCIEAKVKGIIVFGIGLTLRNGNR
FT                   EYYYKNLDKHFKGLKEKYIKQYGNSYEVISKNHGKLMKIIKETCDKNNIICDIREVFNY
FT                   MRTFEEKNNEVQISFEI"
     gtgttagaag ggagttacga ttatatgcat gaggtgatag caaaggggat actatctagt        60
     aataatggaa tgaatattta tagaggatgt actcacggat gtatatattg tgatgctaga       120
     agtctttgtt atggaatgga tcatattttt gaagatatag agattaaggc taatgtggtt       180
     cagttattag aggatacact taagcgtaaa agaaaaaagt gcatgatcgg aacaggtgca       240
     atgagtgatc catacattca gctagaagaa aagcttcaaa acacaagaag atgtttagag       300
     ataattgata agtacggatt tggactagcg atacaaacta aatcaaatag aatattaaga       360
     gatttggact tgttaaaaag tataaatagt aaatcaaagt gtgttgtgca gatgacatta       420
     acaacttatg atgaagaatt atgtaagctt attgaaccaa atgtttctac aacaaaagaa       480
     cgatttgaag ttttaaagat aatgagggat aacaaaattc ctacagtagt ttggctaagt       540
     ccccttttac cttacataaa tgacacggag gaaaatataa gagggatttt agattactgt       600
     atagaagcca aagttaaagg aatcatagta tttggtattg ggttaacatt aagaaatgga       660
     aatagggaat attattataa gaatttagat aagcatttta aaggtttaaa agagaaatac       720
     ataaagcagt atgggaatag ttatgaagta ataagtaaga atcatggaaa acttatgaaa       780
     attattaaag aaacctgtga taaaaataat attatttgtg acataagaga agtttttaat       840
     tatatgagaa cttttgaaga gaaaaataat gaagttcaaa taagttttga gatatag          897
//

If you have problems or comments...

PBIL Back to PBIL home page