(data stored in ACNUC7421 zone)

EMBL: CP002160.PE180

CP002160.PE180       Location/Qualifiers
FT   CDS_pept        268639..269508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0186"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: dhd:Dhaf_2323 transcriptional regulator, AraC
FT                   family; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; transcription
FT                   activator effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49971"
FT                   /db_xref="GOA:D9SNV0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV0"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49971.1"
FT                   /translation="MDWVKQLNESINYIEENLAGEISYEAISKIAGCSIYNFQRMFSYI
FT                   ADKPLSEYIRNRRLTMAAFDLLNSTERIIDISLKYGYESQDSFTRAFKNFHGVLPSSVR
FT                   NETVQLKSCPKRSFQITIKGENHMNYQIEQWPAFRVMGISQKMKTSTAFEMVPKVWENA
FT                   WKDGTMNRFIEKFPDYRPAGFLGIAQGGQWGESEEMEYIIAVTNYVDVPSCEHVPALEG
FT                   MKEFAYPEATWAIFEANGELPEAIQKVYKQFYGEWLPNSGYELADLPVIECYMQDNHQE
FT                   VWIAVIKK"
     atggattggg ttaaacaatt gaacgagtca ataaattata ttgaggagaa tcttgcaggt        60
     gaaatatcct atgaagctat ttcaaaaatt gccggatgtt ctatttataa ttttcaaaga       120
     atgttttcat atatagcaga taagccgttg tctgaatata taagaaacag acggttaact       180
     atggcagcct ttgatttatt gaatagtaca gagagaataa tcgatatttc tttaaagtat       240
     ggatatgaat ctcaagattc atttaccagg gcattcaaaa attttcatgg agtactgcct       300
     tcaagtgtaa gaaatgaaac agttcagtta aaatcttgtc ctaagcgctc ctttcaaatt       360
     acgataaaag gagaaaatca tatgaattat caaattgagc aatggcctgc attcagagta       420
     atgggaatat cacagaaaat gaaaacctca acagcatttg aaatggttcc gaaagtttgg       480
     gagaacgcat ggaaggacgg aactatgaat aggtttattg agaaatttcc tgactataga       540
     ccagcagggt ttttaggaat cgcccaagga gggcaatggg gcgaatcaga ggaaatggaa       600
     tatataatag cagtgacaaa ttatgtagat gtaccaagct gtgaacatgt tcctgcactg       660
     gaagggatga aggaatttgc ttatcctgaa gcaacatggg caattttcga agctaatgga       720
     gaactgccag aagcaataca gaaggtttat aaacaatttt atggagagtg gctacctaat       780
     tccggctatg aattagcgga tcttccggtt attgagtgct atatgcagga taatcatcaa       840
     gaggtttgga tagctgttat aaaaaaatag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page