(data stored in ACNUC7421 zone)

EMBL: CP002160.PE185

CP002160.PE185       Location/Qualifiers
FT   CDS_pept        274820..275998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0192"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   cbe:Cbei_3630 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49976"
FT                   /db_xref="GOA:D9SNV5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADL49976.1"
FT                   /translation="MRDVVIVSAVRTAIGAYGKTLKDVPAVDLGAIVIKEAVKRANIKP
FT                   EEINEVIFGNVLQAGLGQNPARQAAVKAGLPVEIPAFTINKVCGSGLRSISLAAQIIKA
FT                   GDADTIVVGGMENMSSAPFLLDSARWGQRMGHGELVDEMIKDGLWDAFNDYHMGITAEN
FT                   VAEKWNITREEQDEFSLLSQQKAEAAIKNGEFKDEIVPVVIKTKKGEVIFDQDEFPRFG
FT                   NTIEALKKLKPIFKKDGTVTAGNASGLNDGAAALVIMSADKAKALGIKPLAKITSYGSA
FT                   GLDPAIMGYGAFHATKAALDKVNLKAEDLDLIEANEAYASQSIAITKDLNLDMSKVNVN
FT                   GGAIALGHPIGASGARILVTLLHAMEKRDAKRGLATLCIGGGQGTALIVERE"
     atgagagacg tagtaatagt aagcgcagta agaacagcaa taggagcata tggcaaaact        60
     ttaaaagatg taccagcagt tgacttaggt gcaatagtaa taaaagaagc tgttaaaaga       120
     gcaaatatta aaccagaaga aattaatgaa gttatctttg ggaatgtgct tcaagcagga       180
     ttaggacaaa atccagcaag acaagcggct gtaaaagctg gactgcctgt agaaatacct       240
     gcatttacaa ttaataaagt ttgtggttca ggattgagat ctataagttt agcagctcaa       300
     attataaaag ctggcgatgc tgatactatt gtagtaggtg gcatggaaaa tatgtctagt       360
     gcaccatttt tactagatag tgcaagatgg ggacaaagaa tgggccatgg tgagctagtt       420
     gatgaaatga taaaagatgg tttatgggat gcttttaatg attatcatat gggaataaca       480
     gcggaaaatg tggcggaaaa gtggaatata acaagagagg aacaagatga attctcactt       540
     ctatcacaac aaaaagcaga agcagccatt aagaatggag aatttaaaga tgaaatagtt       600
     cctgtagtaa ttaaaacaaa aaaaggtgaa gtaatatttg accaagacga attccctaga       660
     ttcggtaata ctatagaagc attaaaaaaa cttaaaccaa tctttaaaaa agatggtaca       720
     gtgacagcag gaaatgcatc aggactaaat gatggagcag cagctttagt aataatgagt       780
     gcagataaag ctaaagcttt aggaataaaa ccacttgcaa aaattacttc ttatggatca       840
     gcggggttag atccagcgat aatgggatac ggtgcatttc atgcaacaaa agcagcttta       900
     gataaggtta atttaaaagc agaagattta gatttaatag aagcaaatga agcatatgca       960
     tctcaaagta tagcaataac taaggattta aatttagata tgagtaaagt taatgttaat      1020
     ggtggagcta tagcacttgg acatcctata ggggcatctg gtgctcgtat tttggtaaca      1080
     ttgctacatg ctatggaaaa aagggatgcg aagaggggac ttgctactct atgtattggt      1140
     ggaggacaag gtactgcctt aatagttgaa agagaataa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page