(data stored in ACNUC7421 zone)

EMBL: CP002160.PE187

CP002160.PE187       Location/Qualifiers
FT   CDS_pept        279440..280420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0194"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: lsg:lse_0987 MerR family transcriptional
FT                   regulator, putative; PFAM: regulatory protein MerR; SMART:
FT                   regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49978"
FT                   /db_xref="GOA:D9SNV7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV7"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADL49978.1"
FT                   /translation="MDNLIKIKDVSRKYDVTARTLRYYEDMGLLSSTRSDDYTYRMYDE
FT                   NAVRRLEQILILRKLNISIKDIQRVFNTSGSDVVLEVLGKKVQNIDDEVALLHELKEIV
FT                   LDFIREIEQVNFTDNSDIKLLYNKAKEIETQLVTVDYIGKPSNINRLIEITEKLDKKIP
FT                   DIMVVRIPAFKALTCGDQPWGEMFKEGGYMYQLWQYCHLYKSVIFDCFDFLLSKNDKAE
FT                   WICAVKDGVTDADVSPFKLIDFPGGLYAMAVSIDEDNESLRKVEDKVRRWIESTNFELD
FT                   EGRSVMFNMPYLYEYGRDTAYKDIEKGLGYKQMQRYFPIKLKEGI"
     atggacaacc taatcaaaat caaagatgtg tcaaggaaat atgacgttac agctcgtaca        60
     ctgcgttatt atgaggatat gggattgctg tccagcaccc gaagtgatga ctatacatat       120
     agaatgtacg acgaaaatgc tgttaggcgg cttgaacaaa tacttatttt acgcaagctg       180
     aatatcagca taaaagacat tcaacgtgtt ttcaatactt ctggttcaga tgtagtttta       240
     gaagtgctgg ggaaaaaagt acagaacata gacgacgagg ttgcactttt gcatgagttg       300
     aaagaaatcg tgctggattt tatacgtgaa atcgaacaag tgaattttac agacaactcc       360
     gatataaaac tgctgtataa caaggctaaa gagattgaaa cacagttggt aaccgttgat       420
     tatataggca agccttcaaa tataaaccga ttgattgaaa taacagaaaa attagataaa       480
     aaaattccag atataatggt tgtcaggata ccggcattca aagcgttaac gtgcggcgac       540
     caaccgtggg gagaaatgtt caaagaaggg ggatatatgt accaattgtg gcagtattgt       600
     catttgtata agagtgtgat tttcgattgt tttgatttct tgctatctaa aaatgataaa       660
     gctgaatgga tatgtgccgt taaagatggt gttaccgacg ctgatgtaag cccttttaaa       720
     ttaattgatt ttccaggagg cttatacgct atggcagtca gtattgacga agataacgag       780
     agcctacgca aagtggaaga taaagttcgc cgatggattg aaagcacaaa ttttgaactt       840
     gacgaaggcc gcagtgttat gttcaatatg ccttatttat atgaatatgg aagagatact       900
     gcctataaag acatagaaaa gggacttggc tataaacaaa tgcaaagata ttttcccatt       960
     aagctaaaag aaggaatata a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page