(data stored in ACNUC7421 zone)

EMBL: CP002160.PE188

CP002160.PE188       Location/Qualifiers
FT   CDS_pept        280543..281157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV8"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2164"
FT                   /protein_id="ADL49979.1"
FT                   /translation="MEDIKIGSLLSFGNYNWRVLDIQNNRALIITEEVIEERPYHNAYK
FT                   DITWADCALRKYLNGEFYEKFNETDKARIIPVTNKNLDNQWYGSKGGVDTKDSIFLLSL
FT                   EEVCTYFGDSLSKLHNPGKNQRYWFERKDKNNSKRIARLQGQEWGWWWWLRSPGRVNVK
FT                   AVYIFGTDGNIGIQGNNILKGNIDEGRCRGGVRPALWLKLE"
     atggaagata ttaaaatcgg atcattatta tccttcggca attataattg gcgtgtgctt        60
     gatatacaaa acaatagggc tttgattata accgaagaag ttatagaaga acgcccttat       120
     cataatgctt ataaagatat aacatgggct gactgcgcct taagaaaata tcttaatggt       180
     gaattttatg agaaattcaa cgaaactgat aaagcaagaa taattccggt gacaaataaa       240
     aatttggaca atcagtggta tggttcaaaa ggcggagtag atacgaaaga cagtatattt       300
     ttattaagtc ttgaggaagt gtgcacatat ttcggtgata gtctttcaaa actgcataac       360
     ccaggaaaaa atcaaagata ttggtttgaa agaaaagata aaaacaacag taaacgaata       420
     gcaagacttc agggccaaga atggggttgg tggtggtggc ttcggtcccc aggccgcgtt       480
     aatgtaaaag ccgtgtacat atttgggact gacggtaata taggtatcca aggcaacaat       540
     atattgaaag gcaacatcga cgaaggaaga tgtagaggcg gtgtccgtcc agcattgtgg       600
     ctaaagctag aatag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page