(data stored in ACNUC7421 zone)

EMBL: CP002160.PE19

CP002160.PE19        Location/Qualifiers
FT   CDS_pept        30233..30832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0019"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   mno:Mnod_4880 tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49810"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM5"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ADL49810.1"
FT                   /translation="MDPILAQIILWPGNFVPRGWLACEGQELPINQYTALYSLLGTTYG
FT                   GNGSTTFKLPDLRGRVPVGSGICGGINFQQGNSGGNFNVTLTQQQMPAHTHSTTVTQGA
FT                   VTVNGGIPFNGGEGTTNTPSASSKLAVGITAGGDIPNIYNTSEATGSVTGSFTGQVTGT
FT                   TVTVGSAGGNQGVNVMQPFLALRYIIATEGIYPSRD"
     atggatccaa ttttagctca aattatttta tggccaggaa attttgtacc aaggggttgg        60
     ctagcttgcg aaggacagga attaccaata aaccagtaca ctgcacttta ttcactttta       120
     ggaacaactt atggggggaa tggaagtacc actttcaaac taccagattt aagaggaaga       180
     gttccagtag ggtcaggtat ctgcggtggt attaattttc aacaaggcaa cagtggagga       240
     aattttaatg ttacattaac acaacaacaa atgccagcac atacacactc aactactgta       300
     actcaaggag cagtaacagt aaatggagga atacctttta atggaggaga aggcactact       360
     aatacacctt cagcaagttc taaattagca gtaggtatta cagctggtgg ggatatacct       420
     aatatttaca acacatcaga ggcaacgggt tcagttactg gtagctttac aggtcaagtt       480
     actggaacaa cagtaacagt tggaagtgca ggaggcaatc aaggtgttaa tgtgatgcaa       540
     ccatttttag cattaagata tattattgct actgaaggaa tttatcctag tagagattaa       600
//

If you have problems or comments...

PBIL Back to PBIL home page