(data stored in ACNUC7421 zone)

EMBL: CP002160.PE191

CP002160.PE191       Location/Qualifiers
FT   CDS_pept        282796..283527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0198"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbi:CLJ_B0777 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49982"
FT                   /db_xref="GOA:D9SNW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49982.1"
FT                   /translation="MEVIKVHNLYKSYGDVQVVKGVSLTVKKGEIFGLLGANGAGKSTT
FT                   IECILGTKNFDDGQVSILGMNPKKERKKLFQKVGVQFQESNYQDKITVKELCEITEVLY
FT                   KNPLDYNKLLEQFKLQDKVKNLVSELSGGEKQRLFIILALIPRPEVVFLDELTTGLDAK
FT                   ARRDVWKCLLNLKKQGLTIFLTSHFMDEVEILCDNICILKNGVADFYGTVEEAVTLSPY
FT                   EKFEDAYLWFVDEEELNDESI"
     atggaagtaa taaaagttca taatctttat aagtcttatg gggatgttca agtggtgaag        60
     ggtgttagtt taacagtaaa gaaaggtgag atatttggat tacttggggc caatggggca       120
     gggaagagta ctaccataga gtgtatttta gggacaaaga attttgatga tgggcaggta       180
     tctatcctag gtatgaatcc taaaaaagaa agaaaaaagc tatttcagaa ggttggggta       240
     cagtttcaag aatctaatta tcaagataag attacagtga aagagttgtg tgaaataaca       300
     gaagttcttt ataaaaatcc attagattac aacaaattat tagagcaatt taaacttcaa       360
     gataaggtta aaaatctagt aagcgaacta tctggaggtg aaaagcaacg attatttatt       420
     atcctagcat taattccgag gccagaagtg gtattcttag acgagcttac aacaggacta       480
     gatgcaaagg ctagaagaga tgtatggaaa tgcttgttga acttaaaaaa gcaaggactc       540
     acaatctttt taacatcgca ttttatggat gaggttgaaa tactgtgcga taatatatgt       600
     attttaaaaa atggagtagc agatttttat ggaacagttg aagaagcagt gacactgagt       660
     ccatatgaaa aatttgagga tgcttattta tggtttgtag atgaggagga gttgaatgat       720
     gaaagtattt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page