(data stored in ACNUC7421 zone)

EMBL: CP002160.PE194

CP002160.PE194       Location/Qualifiers
FT   CDS_pept        285718..287223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0201"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: lsp:Bsph_3073 hypothetical protein; PFAM:
FT                   chemotaxis sensory transducer; SMART: chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49985"
FT                   /db_xref="GOA:D9SNW4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL49985.1"
FT                   /translation="MTDTYNVKRVHKVSLIMTCLIIFSMIIDATIAGGSKAGITLATRA
FT                   SACVIIGIINYFLPINDYIKGLIFGIVPSISMCLLSALYGFQLSRHYIIICTVGLMALY
FT                   FRKEVTIAHGVITNIALLVTFLVNPDSISGLGTDVEDFIFVLIILDATIAMLYFLSKWG
FT                   RALVNEGAQKTAQSEELLKKLQNTFTKVEDNTDTIDNRISELNSNINCITEASNNITTS
FT                   VQEMAKAIQEEAISVTGVNETMADSLEMVNETWDISKGISNRADVVSEKVSEGWDRMQQ
FT                   MNNQINIISDSISTANTTVSELQSSMETVNNLLQGISEIAVQTNLLALNAAIESARAGE
FT                   HGKGFAVVADEVRKLADQSTIIVNDITQVTTALSNKSQEAFEKVNQGSNAVKEGKELIN
FT                   NISTYFKDIKDTFNDTNTEISKGLSKIEAVADKFLNVQRDMENMAGLAEQNAAATEEIL
FT                   ATIENENTQIIQIGNSLYEIRELSGDLKKMISSNNNRSVMKLN"
     atgacggaca catataacgt taaaagagtt cataaggtaa gtcttattat gacatgttta        60
     atcatatttt ctatgattat tgatgcaact atagcaggag gaagtaaagc cggcattaca       120
     ctggctacac gagcctcagc gtgtgttatt attggtatta tcaattactt tttaccaata       180
     aatgactata ttaaaggttt gatttttgga atagtgccaa gtatcagtat gtgcctgctt       240
     tcagctttat atggatttca actaagtaga cattatatta ttatatgcac tgttgggtta       300
     atggctttat actttagaaa agaggttaca atagcacatg gagttataac aaatatagcg       360
     ttgcttgtta cttttttagt aaatcctgat agtatatcag gtctaggcac ggatgttgaa       420
     gacttcattt ttgtgttgat cattcttgat gctaccattg ctatgttata ttttttaagt       480
     aaatggggaa gagctcttgt gaatgaaggc gctcagaaaa cagcacaatc agaagaactt       540
     ttgaaaaagt tgcagaatac ttttacaaag gtagaagata atacggacac catcgataat       600
     agaataagcg agctgaatag taatataaat tgtataactg aagcaagtaa taatataact       660
     acttcagttc aggagatggc taaagctata caagaagaag ctattagtgt tactggggta       720
     aatgaaacaa tggcggattc attagaaatg gtaaatgaaa cctgggatat atcgaaaggt       780
     atatcaaata gagctgatgt agttagtgaa aaggtcagtg agggctggga tagaatgcag       840
     cagatgaata atcagattaa tattataagt gattctattt ctacagctaa cactactgta       900
     tctgaacttc aatcaagtat ggagacggta aataacttat tacaaggaat atcagaaatt       960
     gcagtgcaaa caaacctttt agcacttaat gctgctatag aatcagcacg tgcaggagag      1020
     catggaaaag gatttgctgt tgttgctgat gaggtaagaa agctagcaga tcaaagtaca      1080
     atcatagtaa atgatataac tcaggtaaca acagcgttat ccaataagtc acaagaggct      1140
     tttgaaaagg ttaatcaagg tagtaatgca gtaaaagagg gtaaagaact tataaacaat      1200
     atatcaacat attttaagga tattaaagat acatttaatg acaccaacac agagatatca      1260
     aaaggattaa gtaaaattga agcagttgca gataagtttt taaatgttca acgtgatatg      1320
     gaaaatatgg caggtttagc agaacagaac gccgcagcta ctgaagaaat attagctact      1380
     attgaaaatg aaaatactca aataattcaa attggtaatt cattatatga aatacgcgaa      1440
     ttaagtggag atcttaagaa aatgattagc tctaataata ataggagcgt aatgaaattg      1500
     aattag                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page