(data stored in ACNUC7421 zone)

EMBL: CP002160.PE195

CP002160.PE195       Location/Qualifiers
FT   CDS_pept        287475..287588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49986.1"
FT                   /translation="MRSLVINKIKVRQDGDNESFSENDDYFRWKRVKSQKS"
     atgagaagtt tggtgataaa taaaattaaa gtaagacaag atggtgataa cgaatcattt        60
     tcagaaaatg atgattattt tcgctggaaa agagttaaat ctcaaaaatc ctaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page