(data stored in ACNUC7421 zone)

EMBL: CP002160.PE196

CP002160.PE196       Location/Qualifiers
FT   CDS_pept        complement(287535..288218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0203"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: cbl:CLK_0304
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49987"
FT                   /db_xref="GOA:D9SNW6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW6"
FT                   /inference="protein motif:PRIAM:2.7.8.13"
FT                   /protein_id="ADL49987.1"
FT                   /translation="MINIVYAILLSFLLSSLIGTILVPIFKKLKLGQNIREEGPKSHYK
FT                   KAATPTFGGIIFILSSIIAMLFFIKQYNEEIQFIFYSLIAFGFIGFLDDFLKKVHKKNQ
FT                   GLTSKQKMILLLFASTTFAIYAYYNPEIGSTIILPFAGKMIDLKLLYIPFIIFIYVATT
FT                   NSVNLTDGLDGLATLVTLLVMVFFALVAFNFRYYTLAIFCGCMCGALLGFLRFNSFPAK
FT                   IIIIF"
     atgatcaata ttgtttatgc cattttatta agtttcttat tatcttccct tattgggact        60
     atacttgtcc caatatttaa aaaattgaaa ctaggtcaga atatccgcga agaaggtccg       120
     aagagtcatt ataaaaaagc agcaactcct acctttggtg gtattatatt tatcctctca       180
     tctataattg caatgttgtt tttcataaag cagtataacg aggaaattca gtttattttc       240
     tattccttaa tagcatttgg ctttataggt tttcttgatg actttttaaa aaaggtacat       300
     aagaagaacc aggggttaac ttcaaaacag aagatgatac tattactttt tgcttccacc       360
     acttttgcaa tttacgcata ttacaatccc gaaatcggat caacaattat ccttcccttt       420
     gcaggaaaaa tgatagatct taaattatta tacataccat ttattatatt catttatgta       480
     gccacaacca attcagtaaa cttgacagat ggcttggacg gtcttgctac attagtaact       540
     ctgctcgtaa tggtattctt tgctttagtg gcttttaatt tccgctatta taccttagca       600
     atcttctgcg gatgcatgtg cggtgcgtta ttaggatttt tgagatttaa ctcttttcca       660
     gcgaaaataa tcatcatttt ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page