(data stored in ACNUC7421 zone)

EMBL: CP002160.PE199

CP002160.PE199       Location/Qualifiers
FT   CDS_pept        289934..290047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49990"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADL49990.1"
FT                   /translation="MINSETIIKKLKEELEPIQYIHAMWLEGADAIGQADE"
     atgattaata gtgaaacgat aatcaaaaag ctcaaagaag aattagaacc gatacaatat        60
     attcatgcaa tgtggcttga gggtgctgat gctataggac aagcagatga atag             114
//

If you have problems or comments...

PBIL Back to PBIL home page