(data stored in ACNUC7421 zone)

EMBL: CP002160.PE2

CP002160.PE2         Location/Qualifiers
FT   CDS_pept        1715..2818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: cno:NT01CX_0866 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49793"
FT                   /db_xref="GOA:D9SMK8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADL49793.1"
FT                   /translation="MNFTCDKTNLQEAISIAQKAVTGKSTMPILQGLLLNARGNKLTIN
FT                   SSDIDLGIETKCNANIKEEGSIVVDSKLFGDIIRKLPNSEIQIKSISEGTIEITCQRSR
FT                   FTLVHMKADEFPQLPYIDEDEIISIPQKLIKNMIRSTIFAIAIDETRPILTGILFEIKN
FT                   RTLNLVALDGFRLALKKETIDTEQEFSAVIPGKTLHEVVKILEDEGDVDITFTTNHILF
FT                   NLGETKVVSRLLEGEFIKYQAIIPEEHELSISVNRASLLNSIERASLVSKDASSNLIKF
FT                   NISEDNIVITSNSQLGDVREEVSIKLLKGNELQIAFNSKYLIDALKIMEEETITLQFTS
FT                   AVSPCIIKNIENDNVIYLVLPVRISNS"
     atgaacttta catgtgataa aactaatttg caagaagcta tctctattgc tcagaaagca        60
     gtaactggta agtctacaat gcctatttta caaggattac ttttaaatgc tagaggaaat       120
     aaactaacaa taaatagttc agatatagat cttggtattg aaactaagtg taatgctaac       180
     atcaaggaag aaggatctat tgtagtagat tcgaagcttt tcggagatat cataagaaaa       240
     ttacctaatt cagaaataca aattaaatca ataagtgaag gaactataga aattacttgc       300
     caaaggtcaa gatttactct tgttcacatg aaagcagatg aatttccaca acttccatac       360
     atagatgaag atgaaatcat ctcaattcct caaaaactta ttaaaaacat gataagatct       420
     acgatatttg caattgcaat agatgaaact agaccgatat taacaggaat attgtttgaa       480
     ataaaaaata gaacgttaaa cttagttgct ttagatggct ttagacttgc gcttaaaaaa       540
     gagacaattg ataccgaaca agaatttagt gcagtaattc caggaaaaac tcttcatgaa       600
     gtagttaaaa tacttgaaga tgaaggggat gttgatataa catttaccac taaccacatt       660
     ttatttaatt taggagaaac aaaagtagtt tcaagacttt tagaaggtga attcataaaa       720
     taccaagcaa taattccaga ggaacatgaa cttagtattt ctgtaaacag agcatctttg       780
     ttaaattcaa tagaaagagc ttcactagtt tcaaaagatg ctagcagtaa tttgatcaaa       840
     ttcaatatta gcgaagataa tattgttatt acttctaatt ctcaattagg tgatgttaga       900
     gaagaggtat ctataaagct actaaaaggt aatgagctac aaatcgcttt taattcaaaa       960
     tatttaatcg atgctttaaa aattatggaa gaagaaacaa taacacttca attcacttca      1020
     gcagtaagtc cttgtataat taaaaatatt gaaaatgata atgttatata cttagttctt      1080
     cctgttagaa tatcaaactc atag                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page